DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: thg1l and THG

Sequence 1:XP_002935942.2 Gene:thg1l XenbaseID:XB-GENE-966760 Length:294 Species:Xenopus tropicalis
Sequence 2:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster

Alignment Length:265 Identity:144/266 (54%)
Similarity:187/266 (70%) Gaps:19/266 (7%)


 Frog    26 MAKSKFEYVRDFEVQDTCLRNCWVLVRVDGRNFHRFAEQHHFTKPNDVRALQLMNRCAQNVMDEL 90
            ||.|:||||:.||..|:.|.|.|:::|:||:.||:|::.|.|.||||..||.:||..|..||.|.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

 Frog    91 DDICLAYGQSDEYSFVFHKKSNWYKRRASKFMTHVVSQFASSYVFYWKEYFPDVPILCPPGFDGR 155
            .||.|||||||||||||.|::..:|||::|.:|:|.|.|:||||..|.::. ::|:...|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

 Frog   156 VVLYPSEQNLKDYLSWRQADCHINNLYNTVFWSLVQKGGLTPAQAQDRLKGTLAAEKNEILFSEF 220
            ||||||||||||||||||||.|:||||||.||.||.:.|||..||:.:|:||.:|:|||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

 Frog   221 NINYNNEPLLYRKGSVLIWQKVNEVSKKRIKLPNEVDEKEVEVSRWRKETVILHCDVIGDQFWEE 285
            .|||||.|.:||||::|:        :||:.|    .||.      |:..|.||.|:|..|||:|
  Fly   195 GINYNNLPAMYRKGTILL--------RKRVIL----GEKS------RQAVVPLHEDLISSQFWKE 241

 Frog   286 HSSIL 290
            |:.||
  Fly   242 HTEIL 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thg1lXP_002935942.2 Thg1 27..283 CDD:226508 138/256 (54%)
Thg1 34..160 CDD:282322 66/126 (52%)
Thg1C 163..278 CDD:291110 61/115 (53%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 138/256 (54%)
Thg1 9..134 CDD:282322 66/126 (52%)
Thg1C 137..234 CDD:291110 61/115 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165992105
eggNOG 1 0.900 E1_COG4021
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5959
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1152974at2759
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.