DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: chd1 and kis

Sequence 1:XP_017946474.1 Gene:chd1 XenbaseID:XB-GENE-960477 Length:1749 Species:Xenopus tropicalis
Sequence 2:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster

Alignment Length:1829 Identity:515/1830 (28%)
Similarity:796/1830 (43%) Gaps:480/1830 (26%)


 Frog     8 DSVSNSNGNSS----------------HSDDD---------------SGSGSGSSSGSSSDGSSS 41
            ||..:||...|                .|||:               |.:.|.|::||..:.:..
  Fly  1512 DSEMDSNKRRSSRNTQRKKYIDDVMLRFSDDENSLLVASPVKKDKKPSANASNSNAGSDVEKTEP 1576

 Frog    42 QSGSS----------------DSESGSESGSQSDSDTSKEKK--------TVQSKPPRL---DGA 79
            |||:.                |..|..|:.|.:.:...||::        .:.|||..:   .|.
  Fly  1577 QSGAEGDAAQEVGEEKSNLPLDESSQLEASSSTSAVAEKERQISTDAANAAMSSKPNYVYINTGD 1641

 Frog    80 EFWKSNPSILAV---QRSAMLRKQQLQQQQQQQRQQASSNSGSDEDSSSSDESDEDSSSDNKKKK 141
            |.......:||:   :|..:|.|.:.:..:.:|.::.|.   .||.::...|.||...::.:.||
  Fly  1642 EDSMVVQLVLAMRMGKRELILDKPKEKAPEPKQDEEKSE---LDEATTDKPEGDEKFKTEGESKK 1703

 Frog   142 --RQDEDWQMSGSGSASDS-----PSASSSSDSDTGGDRQKSSGRD----SESDYEPSHKVKNKK 195
              ...|:.::..|....||     |..|..||.| ..|:.|....|    |:.:.:|..:.:..|
  Fly  1704 DLTDSEETKLESSAMEVDSKEESEPDDSKKSDED-NKDKDKMEVDDEVGKSDKESKPEEQSETVK 1767

 Frog   196 SQNRSK-VKNGKTS-------------------AGQKKRD-------ADSSDDDYDDDYNKRVSR 233
            ::..|| ::..|:|                   ..:|..|       |:.||:...||.|.    
  Fly  1768 TEENSKAIEEDKSSTVLTADHAKEPETVLEKMEVDEKANDDQSAVSKAEGSDEKSTDDSNP---- 1828

 Frog   234 RQATVNVSYKEDEEMKTDSDDLLEVIGEDVPQPEEDEFETIERVMDSRFGRKGATGGTTTIYAVE 298
            .:||...: ||..|::.:.:.:.|  ||:..:.|.||                         ..|
  Fly  1829 EEATTEKN-KESLEIEGEKERVKE--GEESVKKENDE-------------------------KTE 1865

 Frog   299 AD--GDPNANFNETKEAGETQYLLKWKGWSSIHNTWETEDTLKQQNVKGMKKLDNYKKKEQEKKR 361
            ||  ..|...|.:.:|     |.:|::.:|.:|..|.||:.|.:.:.:...|:..:::|:.::  
  Fly  1866 ADMENKPEPVFIDVEE-----YFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQ-- 1923

 Frog   362 WLKAASPEDIEYYNCQQELIDD-LHKQYQIVERII---AHSNQKSAAGYPDYFCKWQGLPYSECS 422
                        .|..:.:.|: .::.:..|:|::   .|:::.|......|..||:.|||.:|:
  Fly  1924 ------------LNIFENIEDEPFNQDFTEVDRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCT 1976

 Frog   423 WEDGALIAKKFQARIDEYISRNQSKTIPFKECKVLKQRPR---FVALKKQPSYIGGNKQLELRDY 484
            ||   |.......:|::|:..|:   ||.:.....|:||.   :..|:|.|.|.|||   .||.|
  Fly  1977 WE---LEEDVDNDKIEQYLRFNK---IPQRSEWKSKKRPHPELWKKLEKTPVYKGGN---SLRPY 2032

 Frog   485 QLDGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREI 549
            ||:|||||..||...::||||||||||||||:::|::.:: |:.:.||||::.||||:.:||||.
  Fly  2033 QLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVY-EYGIRGPFLVIAPLSTIPNWQREF 2096

 Frog   550 QIWAPLMNAVVYLGDINSRNMIRTHEWMHPQ------TKRLKLNVLLTTYEILLKDKSFLGGVNW 608
            :.|.. ||.|||.|.:.|:.||:.:|:.:..      .:.:|.|||:||:|:::.|...|...||
  Fly  2097 EGWTD-MNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNW 2160

 Frog   609 AFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEE 673
            ....:||||||||.:..|.:.|......||:|::||||||::.||:|||:|:.|.:|||.|:|..
  Fly  2161 RLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMS 2225

 Frog   674 EHGKGR-EYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRVEMSASQKQYYKWILTRNYKAL 737
            |.|..| |.....|...|:|.:|||:|.||||||..|.|.|:.||::..||:||:.||.:|:..|
  Fly  2226 EFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFL 2290

 Frog   738 SKG-SKGSTSGFLNIMMELKKCCNHCYLIKPPEENEFYNRQEALQH----------LIRSSGKLI 791
            .|| :..:....:|.||||:|||.|.||:...||...|:.:.  ||          ||.|:||::
  Fly  2291 KKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKS--QHGEDPESYYKNLILSAGKMV 2353

 Frog   792 LLDKLLVRLRERGNRVLIFSQMVRMLDILAEYLKSRQFPFQRLDGSIKGEVRKQALDHFNAEGSE 856
            |:||||.:|:..|:||||||||||.||||.:||..|::||:|:||.|:|.:|::|:|.::..||:
  Fly  2354 LIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSD 2418

 Frog   857 DFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEED 921
            .|.|||.|:||||||||.:||||:|:|||||||||||||||.|||||:|.|.||||:.:.:.|.:
  Fly  2419 RFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYERE 2483

 Frog   922 IIERAKKKMVLDHLVIQRMDTTGKTVLHTGSTPSSSTPFNKEELAAILKFGAEELFKEPEGEEEE 986
            :.::|..|:.||..|:|.|:|       .||...::...:|:|:..:||.||.....:.:...::
  Fly  2484 MFDKASMKLGLDKAVLQSMNT-------QGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNAGDK 2541

 Frog   987 PQEMDIDEILKRAE---TRENEGGPLTVGDELLSQFKVANFS--------TMEEDDM-------- 1032
            ..|.|||.||||..   |.|:|.|         |.|..|:|:        |:::.|.        
  Fly  2542 FCEEDIDSILKRRTQVITMESEKG---------STFSKASFAASGNRSDITIDDPDFWTKWAKKV 2597

 Frog  1033 -VEPN---RDSKSWEDIIPTDQRRRME-EEEREKELQEIYLLPRMRNCAKQANFNGSE----GRR 1088
             ::|:   ||..  ||::.::.|||.: :....:::.|:       |..:.:|.|..|    |.|
  Fly  2598 DIDPDACERDET--EDLVLSEPRRRTQIKRYGHEDVMEL-------NSEESSNENSDEEGGIGLR 2653

 Frog  1089 SRNRRYSGSDSDSMSDRKRPKKRGRPRTIPREN----IKGFSDAEIRRFIKS--YK------KFG 1141
            ||.|:       ...||.|.|| |....||||.    ..|..:.:...:.||  :|      .||
  Fly  2654 SRRRK-------EKRDRAREKK-GNDEYIPRERDALAALGLEEIQYGNWAKSECFKVEKGLLSFG 2710

 Frog  1142 GPLERLDAIARDAELVDKS-------ETDLRRLGELIHSGCIKALK------------------- 1180
            .        .|.:||::..       :.|:.....:|...|::..|                   
  Fly  2711 W--------GRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDG 2767

 Frog  1181 -------DSSG------QERAGGRRGKMKGPTFRISGVQVNA--KLVSSHEDELAPLHKSIPSDP 1230
                   |.||      :.|.||:..|      ..:||...|  ....|:.....|.|||...|.
  Fly  2768 EVQKISRDHSGLHNLVPRGRNGGKSNK------ESTGVSTPAPGSASGSNSGNTTPAHKSSALDG 2826

 Frog  1231 DERKRYVIPCHTKAA-----HFDIDWGKED----------------------------------- 1255
            .::....|.....||     |....|.|::                                   
  Fly  2827 SDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVLLRVRMLYYIQH 2891

 Frog  1256 ----------------------------------------DSNLLIGIYEYGYGSWEMIKMDPDL 1280
                                                    |.:||:|.|::|...:..::.||:|
  Fly  2892 EVIGDFVQQIKDNTPISELPIRPPPTPDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNL 2956

 Frog  1281 -------------NLTQKILP----------DDPDKKPQAKQLQTRADYLIKLL---NKDLL--- 1316
                         :|....||          ||.|:........|:.....||.   |||.|   
  Fly  2957 CFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSDSTKLTGGDNKDSLLDP 3021

 Frog  1317 ------RKEAQRLSSGGNSKRRKTRAKKSKNVKPVKVEEETKSESSPPSSEN---SEEEEDQEET 1372
                  .|.:...:||||.|      .:|:|......|...|||..|....:   |..::|....
  Fly  3022 ERPSSSGKSSSENASGGNDK------TESENDATTVSESSYKSEVLPGKGSDLDVSVAQQDALSA 3080

 Frog  1373 VPLRTNNKRRAEKENEDRTELDVSVNKEPEEKK---------------------EIKENKKDPKK 1416
            .|...|..  ..|.|::..::..||:.:|.:..                     :|:..|||  .
  Fly  3081 TPELANTS--DPKMNKNDAQVSASVSCDPADSSSPEAAGKAQGTGVQTGDAGELDIESEKKD--N 3141

 Frog  1417 EKKEKEEKRDTTEKEA-RDKKEIKTKEPVKEKEIKEEKVTEVKAEKEKPKKSILADTPVHITASS 1480
            ||:.||...|....|| :|...|...|..|.:.......|.:        .:....|.:..|.::
  Fly  3142 EKETKESTGDAPAVEAKKDSAAIARAEGDKTESCTNNATTNI--------STTTTTTTITNTTTT 3198

 Frog  1481 EPVPISEEA 1489
            ...|.|:.|
  Fly  3199 TNNPSSKAA 3207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
chd1XP_017946474.1 None
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 52/236 (22%)
HepA 1676..2527 CDD:223627 334/926 (36%)
SDA1 <1693..>1854 CDD:283052 38/169 (22%)
CHROMO <1879..1919 CDD:237991 10/45 (22%)
Chromo 1941..1996 CDD:278797 17/58 (29%)
DEXDc 2048..2197 CDD:238005 65/151 (43%)
Helicase_C 2350..2464 CDD:278689 74/114 (65%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.