DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stx7 and Syx7

Sequence 1:XP_002936355.1 Gene:stx7 XenbaseID:XB-GENE-1004004 Length:259 Species:Xenopus tropicalis
Sequence 2:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster

Alignment Length:268 Identity:95/269 (35%)
Similarity:146/269 (54%) Gaps:35/269 (13%)


 Frog     8 DPAQLAQTISGNIQKITQSSSEIQRIVNQLGTVQDTAELRNRLQEKIQYAHKIAKDT-------D 65
            |..:|||.|:.:|||:.|:.|.:||:||||.|.||:.||:.:|.:.:.|.:::..||       |
  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEVD 86

 Frog    66 RCLKDYASLPLESDQRQRKLQKDRLVSEFSSVLNNFQKIQRQAAEKEKEF----------VARVR 120
            :|           .:|..|:|:||||.||::.|..||.:||:.|:.||..          :||..
  Fly    87 KC-----------KERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPP 140

 Frog   121 AGSRVSGGFPDDSQKEGSLLTWEN-----EGQPQATMQEEEITEDDLHLIEERETAIRQLEEDIQ 180
            ..||........||::.:....:|     ..|.|...|.||  :.||..:||:|..||:||.:|.
  Fly   141 GSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEE--QADLQALEEQEQVIRELENNIV 203

 Frog   181 GINDIFKDLGMMVHEQGEMIDSIEANVENADVHVQQANQQLARAAEYQRKSRRKICIIIAVLVVA 245
            |:|:|:|.||.:|:|||..:||||:.||...:.|.|..:.|.:|:.|:.|.|:|..|::.:|...
  Fly   204 GVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAV 268

 Frog   246 ATVIGLII 253
            ...|.||:
  Fly   269 LLAIILIL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stx7XP_002936355.1 Syntaxin 13..197 CDD:279182 73/206 (35%)
Syntaxin_2 16..116 CDD:291208 40/117 (34%)
SNARE_syntaxin7 165..224 CDD:277228 27/59 (46%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 40/107 (37%)
COG5325 <97..276 CDD:227635 65/181 (36%)
SNARE 188..247 CDD:304603 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66168834
eggNOG 1 0.900 E1_COG5325
Hieranoid 1 1.000
Homologene 1 1.000 H37823
Inparanoid 1 1.050 155 1.000 Inparanoid score I4092
OMA 1 1.010
OrthoDB 1 1.010 D1204812at2759
OrthoFinder 1 1.000 FOG0000767
OrthoInspector 1 1.000 T601080
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3589
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.