DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wu:fd14a01 and zip

Sequence 1:XP_017208743.1 Gene:wu:fd14a01 ZFINID:ZDB-GENE-030131-5336 Length:1936 Species:Danio rerio
Sequence 2:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster

Alignment Length:1988 Identity:753/1989 (38%)
Similarity:1194/1989 (60%) Gaps:83/1989 (4%)


Zfish     5 EMECFGPAAIYLRKTERERIE--AQNTPFDAKTAYFVVDADEMYLKGTLQSKEGGKATVK-THSG 66
            |::...|...|| ..||.:..  |....:..|...:|...::.::..:::.:.|.:..|: ..:|
  Fly    49 EVDRNDPELKYL-SVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETG 112

Zfish    67 KTVTVKEDEIFPMNPPKFDKIEDMAMMTHLNEPCVLYNLKERYAAWMIYTYSGLFCVTVNPYKWL 131
            |.|.:..|:|..||||||||:||||.:|.|||..||:|:|:||.:.:||||||||||.|||||.|
  Fly   113 KRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKL 177

Zfish   132 PVYDAIVVAGYRGKKRIEAPPHIFSISDNAYQFMLTDRENQSVLITGESGAGKTVNTKRVIQYFA 196
            |:|...::..|:|.||.|.|||:|:|:|:||:.||.|||:||:|.|||||||||.|||:|||:.|
  Fly   178 PIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLA 242

Zfish   197 -----------------------------------------TVGAMSGAKKQEPVAGKMQGSLED 220
                                                     |:..::|.|..|..:...:|.||.
  Fly   243 YVAASKPKGSGAVPHPAVLINFSVNTNKYIKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEGELEQ 307

Zfish   221 QIVAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLSAERSY 285
            |::.|||:|||:||||||:|||||||||||||:|..:|.::.|:||||||||||...|...||::
  Fly   308 QLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTF 372

Zfish   286 HIFYQLMTGHKPELLEALLITTNPYDYPMISQGEITVKSINDVEEFIATDTAIDILGFTADEKIA 350
            ||||||:.|..||..|..:: .:...|..:|.|.:.|..::|..||.||..:::|:|.|:::..:
  Fly   373 HIFYQLLAGATPEQREKFIL-DDVKSYAFLSNGSLPVPGVDDYAEFQATVKSMNIMGMTSEDFNS 436

Zfish   351 IYKLTGAVMHHGSMKFKQKQREEQAE-PDGTEVADKIAYLMGLNSADMLKALCYPRVKVGNEMVT 414
            |:::..||:..|||||:|::..:||. ||.| ||.|||:|:||:..||.:|...||:|||.:.||
  Fly   437 IFRIVSAVLLFGSMKFRQERNNDQATLPDNT-VAQKIAHLLGLSVTDMTRAFLTPRIKVGRDFVT 500

Zfish   415 KGQTVPQVNNAVSALCKSVYEKMFLWMVIRINEMLD-TKQPRQFFIGVLDIAGFEIFDFNSLEQL 478
            |.||..||..||.|:.|:.||:||.|:|.|||..|| ||:....|||:||:||||||:.||.|||
  Fly   501 KAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQL 565

Zfish   479 CINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFP 543
            |||:|||||||.|||.||:||||||::|||||:|||||:||...|:||:||.||.::|:|||.||
  Fly   566 CINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPGGIMALLDEECWFP 630

Zfish   544 KATDTSFKNKL---HDQHLGKCSAFQKPKPAKG--KAEAHFSLVHYAGTVDYNIVGWLDKNKDPL 603
            ||||.:|.:||   |..|         ||..|.  :..|.|::|||||.|||:...||.||.|||
  Fly   631 KATDKTFVDKLVSAHSMH---------PKFMKTDFRGVADFAIVHYAGRVDYSAAKWLMKNMDPL 686

Zfish   604 NDSVVQLYQKSSLKVLAFLYASHGGEAEGGGGKK--------GGKKKGGSFQTVSALFRENLGKL 660
            |:::|.|.|.|....:..::.    :||..|..:        |.:.:.|.|:|||.|::|.|.||
  Fly   687 NENIVSLLQGSQDPFVVNIWK----DAEIVGMAQQALTDTQFGARTRKGMFRTVSHLYKEQLAKL 747

Zfish   661 MTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYK 725
            |..||:|:|:||||:|||..|..|.::..||:.|||||||||||||||:|||:||.:.:|:|||:
  Fly   748 MDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICRQGFPNRIPFQEFRQRYE 812

Zfish   726 VLNASVIPEGQFIDNKKASEKLLGSIDVDHTQYKFGHTKVFFKAGLLGTLEEMRDEKLASLVTMT 790
            :|..:|||:| |:|.|||.||::.::::|...|:.|.:|:||:||:|..|||.||.|::.|:...
  Fly   813 LLTPNVIPKG-FMDGKKACEKMIQALELDSNLYRVGQSKIFFRAGVLAHLEEERDFKISDLIVNF 876

Zfish   791 QALCRGYVMRKEFVKMMERREAIYSIQYNIRSFMNVKHWPWMKLYFKIKPLLKSAETEKEMAAMK 855
            ||.|||::.|:.:.|.:::..||..||.|..:::.:::|.|.:||.|:||||:..:.|:::...:
  Fly   877 QAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKLVQKE 941

Zfish   856 ENYEKMKEDLTKALAKKKELEEKMVSLLQEKNDLQLQVASEGENLSDAEERCEGLIKSKIQLEAK 920
            :..::::|.|.......:|.|.|....|.||..|..|:.:|.|..::|||....|:..|.:||..
  Fly   942 DELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCAEAEESRSRLMARKQELEDM 1006

Zfish   921 LKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMA 985
            ::|...|:|:|||....|..:|:|||....:|::.:::.|....|::.||...:.|:|...|::|
  Fly  1007 MQELETRIEEEEERVLALGGEKKKLELNIQDLEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLA 1071

Zfish   986 SQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKSKSKLEQQVDDLEGSLEQEKKLRMDL 1050
            ..|:...||.||||.|:|........|..||:|...|.|.|:|.|..:.:||..|.::::.|.:.
  Fly  1072 LTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQES 1136

Zfish  1051 ERAKRKLEGDLKLAQESIMDLENDKQQSEEKIKKKDFEISQFLSKIEDEQSLGAQLQKKIKELQA 1115
            :|:|||:|.::...:|.:.:......:.:.::.|::.|::|.|.:|::|.:..|..||..:||::
  Fly  1137 DRSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESATKATAQKAQRELES 1201

Zfish  1116 RIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDL 1180
            ::.|::|::|||:|||||.||.|.|||.|||.:...|.::...||||.|:..|||.|...|::.|
  Fly  1202 QLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSL 1266

Zfish  1181 EESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKA 1245
            ||.|:.||...|.:|.|.:..:..:.:|::||::.|..|||.|...:.|..||::.:.:|..::.
  Fly  1267 EEETVNHEGVLADMRHKHSQELNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQ 1331

Zfish  1246 NLEKMCRTLEDQLSEIKTKSDENIRQLNDMNAQRARLQTENGEFSRQLEEKEALVSQLTRGKQAY 1310
            ..::..:..|.|::|::.|..|..|..:::..:..:||.|....:.||||.|...|...:.....
  Fly  1332 ENDRRRKQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKASAAVKSASNM 1396

Zfish  1311 TQQIEELKRHVEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRT 1375
            ..|:.|.::.:|||.:.|..|:..::....:.:.|:||.||:.|||...:|.:::..:::.:.:.
  Fly  1397 ESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEEDDEAKRNYERKLAEVTTQMQEIKK 1461

Zfish  1376 KYETDAIQRTEELEESKKKLAQRLQDAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANAL 1440
            |.|.|| ...:||||.||:|.:.::..|..::.:.::...|:|:|:::|.|:||..|::|.....
  Fly  1462 KAEEDA-DLAKELEEGKKRLNKDIEALERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTK 1525

Zfish  1441 AANLDKKQRNFDKVLAEWKQKYEEGQAELEGAQKEARSLSTEIFKMKNSYEEALDQLETLKRENK 1505
            ...|:|||:||||:|||.|...|:...|.:.|::|||...|::..:....:||.|::|.|:.:.|
  Fly  1526 VLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLENKRK 1590

Zfish  1506 NLQQEISDLTEQLGETGKSIHELEKAKKTVESEKVEIQTALEEAEGTLEHEESKILRVQLELNQV 1570
            .||.|:.||....|...|::|||||||:.:||:..|::...||.|..|:..|...||:::.:..:
  Fly  1591 TLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDDLQLTEDAKLRLEVNMQAL 1655

Zfish  1571 KSEIDRKLAEKDEEIEQIKRNSQRVLDAMQSTLDSEVRSRNDALRVKKKMEGDLNEMEIQLSHAN 1635
            :|:.:|.|..|:|..|:.:|...:.|..:::.||.|.:.|..|:..|||:||||.|:|..:...|
  Fly  1656 RSQFERDLLAKEEGAEEKRRGLVKQLRDLETELDEERKQRTAAVASKKKLEGDLKEIETTMEMHN 1720

Zfish  1636 RQAAEAQKQLRNVQGQLKDAQLHLDEAVRGQEDMKEQVAMVERRNNLMQAEIEELRAALEQTERG 1700
            :...:|.|..:.:|.|:|||....:||...:|:::......||:...::||:.:|...|..:||.
  Fly  1721 KVKEDALKHAKKLQAQVKDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERA 1785

Zfish  1701 RKVAEQELVDASERVGLLHSQNTSLINTKKKLEADLVQIQGEVDDAVQEARNAE---EKAKKAIT 1762
            |:.||.|..:.:|.:....::.:.:|:.|::|||.:..::.|::   :|..|:|   ::::||..
  Fly  1786 RRAAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELE---EEQSNSEVLLDRSRKAQL 1847

Zfish  1763 DAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELESE 1827
            ....:..||..|:..|...|..:..||...|:|:.:|.|.|.......|..:..||:::..||.:
  Fly  1848 QIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEIETAQRTKVKATIATLEAKIANLEEQ 1912

Zfish  1828 VEAEQRRGADAVKGVRKYERRVKELTYQTEEDKKNVTRLQDLVDKLQLKVKAYKRQAEEAEEQAN 1892
            :|.|.:......|..||.::::||||...|:::::|.:.::.:|||..::|..||..:|.||:..
  Fly  1913 LENEGKERLLQQKANRKMDKKIKELTMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQ 1977

Zfish  1893 THLSRYRKVQHEMEEAQERADIAESQVNKLRAKSRDAG 1930
            ...::.||.|.|.|:..|..:....::|.|:.|.|..|
  Fly  1978 KEKTQKRKYQRECEDMIESQEAMNREINSLKTKLRRTG 2015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wu:fd14a01XP_017208743.1 Myosin_N 34..72 CDD:308391 7/39 (18%)
MYSc_class_II 99..768 CDD:276951 354/725 (49%)
SMC_N 848..1925 CDD:330553 333/1080 (31%)
zipNP_523860.2 Myosin_N 80..117 CDD:280832 6/37 (16%)
Myosin_head 133..854 CDD:278492 362/737 (49%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 354/725 (49%)
Myosin_tail_1 931..2011 CDD:279860 334/1084 (31%)
Prefoldin 1431..1515 CDD:298833 28/85 (33%)
FAM76 <1847..1926 CDD:292665 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.