DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPDL and CG4612

DIOPT Version :9

Sequence 1:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:318 Identity:78/318 - (24%)
Similarity:128/318 - (40%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    47 PSSARQGARRAQRHVTA-----QQPSRLAGGAA----IKGGRRRRPDLFRRHFKSSSIQRSAAAA 102
            |::..|.......|..|     ||....|..|.    :.||          |..|:.:     ||
  Fly    12 PANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGG----------HAASNHL-----AA 61

Human   103 AATRTARQHPPADSSVTMEDMNEYSNI------EEFAEGSKINASKNQQ-DDGKMFIGGLSWDTS 160
            ||......|....|..|....:. :|:      ...|.||...:..|.. |.||::|..|.....
  Fly    62 AAVLGRHGHNSLGSGHTSTSSHS-ANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSID 125

Human   161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLID------ 219
            .|.:.:..|.||.:::|.:..|. .|.|||:|||.|....:....:|    |::|.|.:      
  Fly   126 NKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIE----KVNGMLCNNQKVHV 185

Human   220 ----PKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFIT 280
                |:|.:..:.....|.::|..||.:.:|:.::|.|..:|.|.:.:|.:|.:...|| |.|:.
  Fly   186 VKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVA 249

Human   281 YTDEEPVKKL-----LESRYHQIGSGK------CEIKVAQPKEVYR--QQQQQQKGGR 325
            |  |.|...|     |..:  |:|..|      ...|..:.:|:.|  :::::||.|:
  Fly   250 Y--ENPQSALAAVIGLHGK--QLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120 6/23 (26%)
RRM1_hnRPDL 149..224 CDD:410152 23/84 (27%)
RRM2_hnRPDL 234..308 CDD:409998 23/84 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348 4/15 (27%)
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/74 (27%)
RRM3_I_PABPs 202..282 CDD:240826 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.