DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPDL and CG10466

DIOPT Version :10

Sequence 1:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:148 Identity:39/148 - (26%)
Similarity:68/148 - (45%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   123 MNEYSNIE--------EFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTI 179
            ||..:|::        |...|.|.:.....:|...:|:.|..:..::.||....|::||||:..:
  Fly     1 MNPLTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINL 65

Human   180 KTDPVTGRSRGFGFVLFKDAAS----VDKVLELK--------EHKLDGKLIDPKRAKALKGKEPP 232
            ..|..||:|:||.|:.::|..|    ||.:..:|        :|..|.|  .||..:  |..|..
  Fly    66 IRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYK--PPKENE--KMDEET 126

Human   233 KKVFVGGLSPDTSEEQIK 250
            .::::.|.:|....:.||
  Fly   127 LRLYMEGCAPKPQLQHIK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120
RRM1_hnRPDL 149..224 CDD:410152 26/86 (30%)
RRM2_hnRPDL 234..308 CDD:409998 4/17 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420
Necessary for its nuclear import and export 396..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.