DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPDL and gar2

DIOPT Version :9

Sequence 1:NP_112740.1 Gene:HNRNPDL / 9987 HGNCID:5037 Length:420 Species:Homo sapiens
Sequence 2:NP_593531.1 Gene:gar2 / 2542869 PomBaseID:SPAC140.02 Length:500 Species:Schizosaccharomyces pombe


Alignment Length:341 Identity:84/341 - (24%)
Similarity:147/341 - (43%) Gaps:67/341 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    91 KSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEE-------FAEGSKINASKNQQDDG 148
            |..|.:.|:.:.:::.::.:...:|||...|  :|.|:.:|       .:|......:|..||..
pombe   198 KEGSSESSSDSESSSDSSSESGDSDSSSDSE--SESSSEDEKKRKAEPASEERPAKITKPSQDSN 260

Human   149 K---MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE 210
            :   :|:|.|||:...:.|.:....:|.:|...:..|..:|||:|:|:|.|:...:....:....
pombe   261 ETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAANG 325

Human   211 HK-LDGKLI-----DPKRAKAL------------KGKEPPKKVFVGGLSPDTSEEQIKEYFGAFG 257
            .| :||:::     :|:.|...            :..||...||||.||.:.:|:.:...||..|
pombe   326 TKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNATEDDLSTAFGGCG 390

Human   258 EIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQK 322
            :|::|.||.|.::...:||.::|::|.:..||.:|...|.|....|.:..:.|:.          
pombe   391 DIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAGRPCRLDFSTPRT---------- 445

Human   323 GGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNY 387
              .|.:.|||||..|||                        .:||...:.|..|....|...||.
pombe   446 --GGGSRGGRGGFGGRG------------------------GFGGRGGFGGGRGRGRGGARSGNP 484

Human   388 GYGQGYADYSGQQSTY 403
            ..| ..|.:||.:.|:
pombe   485 NRG-SVAPFSGNKVTF 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPDLNP_112740.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..120 4/23 (17%)
RRM1_hnRPDL 149..224 CDD:410152 20/83 (24%)
RRM2_hnRPDL 234..308 CDD:409998 25/73 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..348 9/34 (26%)
Necessary for interaction with TNPO1. /evidence=ECO:0000269|PubMed:9524220 342..420 12/62 (19%)
Necessary for its nuclear import and export 396..420 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..420 2/6 (33%)
gar2NP_593531.1 RRM1_gar2 264..339 CDD:240893 19/74 (26%)
RRM2_gar2 368..439 CDD:240894 25/70 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.