powered by:
Protein Alignment NR1I3 and Hr96
DIOPT Version :9
Sequence 1: | XP_005245750.1 |
Gene: | NR1I3 / 9970 |
HGNCID: | 7969 |
Length: | 429 |
Species: | Homo sapiens |
Sequence 2: | NP_524493.1 |
Gene: | Hr96 / 42993 |
FlyBaseID: | FBgn0015240 |
Length: | 723 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 24/56 - (42%) |
Similarity: | 36/56 - (64%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 118 TCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQ 173
||||..:|:::...||.|..|||:||||.||:.:.|:|.|...::|.|....||::
Fly 42 TCPFNQNCDITVVTRRFCQKCRLRKCLDIGMKSENIMSEEDKLIKRRKIETNRAKR 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165157573 |
Domainoid |
1 |
1.000 |
99 |
1.000 |
Domainoid score |
I7079 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
168 |
1.000 |
Inparanoid score |
I4152 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D153746at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24082 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X988 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
8 | 8.000 |
|
Return to query results.
Submit another query.