DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NR1I3 and Hr96

DIOPT Version :9

Sequence 1:XP_005245750.1 Gene:NR1I3 / 9970 HGNCID:7969 Length:429 Species:Homo sapiens
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:56 Identity:24/56 - (42%)
Similarity:36/56 - (64%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   118 TCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQ 173
            ||||..:|:::...||.|..|||:||||.||:.:.|:|.|...::|.|....||::
  Fly    42 TCPFNQNCDITVVTRRFCQKCRLRKCLDIGMKSENIMSEEDKLIKRRKIETNRAKR 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NR1I3XP_005245750.1 NR_DBD_like <108..154 CDD:295381 17/35 (49%)
NR_LBD_PXR_like 178..427 CDD:132732
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 24/56 (43%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157573
Domainoid 1 1.000 99 1.000 Domainoid score I7079
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D153746at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X988
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.