DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDC34 and Ubc84D

DIOPT Version :9

Sequence 1:XP_005259747.1 Gene:CDC34 / 997 HGNCID:1734 Length:269 Species:Homo sapiens
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:156 Identity:41/156 - (26%)
Similarity:69/156 - (44%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     8 SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSP 72
            ::.:.|..||..|.|..:...|.....:..|..| ..:..|....|..|.|:..:.||..||:.|
  Fly     2 AATRRLTRELSDLVEAKMSTLRNIESSDESLLMW-TGLLVPEKAPYNKGAFRIEINFPPQYPFMP 65

Human    73 PAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTF 137
            |...|.||::|||:.|.|:||:.|            :.::.|.||.....:|.:::::::.|...
  Fly    66 PKILFKTKIYHPNVDEKGEVCLPI------------ISTDNWKPTTRTEQVLQALVAIVHNPEPE 118

Human   138 SPANVD-ASVMYRKWKESKGKDREYT 162
            .|...| |....|:.|:......|:|
  Fly   119 HPLRSDLAEEFVREHKKFMKTAEEFT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDC34XP_005259747.1 COG5078 6..162 CDD:227410 40/154 (26%)
UBCc 11..162 CDD:238117 40/151 (26%)
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 41/156 (26%)
UBCc 6..149 CDD:214562 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.