DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDC34 and CG7656

DIOPT Version :9

Sequence 1:XP_005259747.1 Gene:CDC34 / 997 HGNCID:1734 Length:269 Species:Homo sapiens
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:164 Identity:127/164 - (77%)
Similarity:146/164 - (89%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     7 PSSQ--KALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYP 69
            |||.  :||.:|.|.|||||||||||.|:::.:|:.|||||||||:|.|:||||||.:|||.|||
  Fly    37 PSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYP 101

Human    70 YSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEP 134
            ||||:.|||||:||||:||.||:||||||||||||||||||.|||||||||||||||||||||||
  Fly   102 YSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEP 166

Human   135 NTFSPANVDASVMYRKWKESKGKDREYTDIIRTQ 168
            |||||||||||||||:|::|:|||.||.:|||.|
  Fly   167 NTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDC34XP_005259747.1 COG5078 6..162 CDD:227410 122/156 (78%)
UBCc 11..162 CDD:238117 119/150 (79%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 114/143 (80%)
COG5078 45..182 CDD:227410 111/136 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1980
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 339 1.000 Inparanoid score I2376
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - otm41850
orthoMCL 1 0.900 - - OOG6_104162
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4188
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.