DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDC34 and Ubc4

DIOPT Version :9

Sequence 1:XP_005259747.1 Gene:CDC34 / 997 HGNCID:1734 Length:269 Species:Homo sapiens
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:171 Identity:57/171 - (33%)
Similarity:82/171 - (47%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    22 EEPVE-GFRVTLVDEGDLYNW-----EVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTK 80
            ||.|: ..::.||::    :|     |:|  |||:|.||||.|...:|.|..||::||..||:|:
  Fly    20 EEIVQCSIKIELVND----SWTELRGEIA--GPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITR 78

Human    81 MWHPNIYE-TGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDA 144
            :|||||.. ||.:|:.||             .:.|.....:||:|||:.:||.......|.  ||
  Fly    79 IWHPNISSVTGAICLDIL-------------KDNWAAAMTLRTVLLSLQALLAAAEPDDPQ--DA 128

Human   145 SVMYRKWKESKGKDREYTDIIRTQEH--------PGHLPSC 177
            .|.|      :.||: |...:.|.:|        |...|.|
  Fly   129 VVAY------QFKDK-YDLFLLTAKHWTNAYAGGPHTFPDC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDC34XP_005259747.1 COG5078 6..162 CDD:227410 51/146 (35%)
UBCc 11..162 CDD:238117 51/146 (35%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 54/160 (34%)
UQ_con 8..149 CDD:278603 54/156 (35%)
UBA_II_E2_UBCD4 163..198 CDD:270574 57/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.