DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USP3 and scny

DIOPT Version :9

Sequence 1:NP_006528.2 Gene:USP3 / 9960 HGNCID:12626 Length:520 Species:Homo sapiens
Sequence 2:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster


Alignment Length:367 Identity:108/367 - (29%)
Similarity:170/367 - (46%) Gaps:60/367 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   159 TGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVS------ 217
            ||:.|:||||::|:.||:|.:|          ||:       |...........|.||:      
  Fly   172 TGMINVGNTCYLNSTLQALLHI----------PAL-------ANWLVSEQAHLADCNVAEPGSGC 219

Human   218 LVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGF-N 281
            ::....|||.|. |.:|:|..|..::..:.:|..:....:|:|||||:|:|::.:.......| |
  Fly   220 IICAMTKTLLAT-QSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRN 283

Human   282 GVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPS 346
            ......:::|.:.|.               .||||.|::||.||.|...|..|..|.||.|||  
  Fly   284 YKELDQLVKETTPLG---------------QIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDI-- 331

Human   347 QFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHL 411
                 |..:       ||.|........|.|::.. |.|..||||..:||:|.:::.|..||:.|
  Fly   332 -----RKAD-------SLEDAFEGHFSRERLEDMG-YKCEGCKKKVSATKQFSLERAPITLCIQL 383

Human   412 KRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAY- 475
            |||   :.:.||:...:.|..| :|:..|....:.:..:...|.|.::|.|.|:....|||||. 
  Fly   384 KRF---SMIGNKLTKQISFKSR-IDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIG 444

Human   476 ATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGS 517
            :|..|.:::|:||.|......:|....|||:|:....::|.|
  Fly   445 STDTGSFYNFDDSYVRPIAMHSVCNTNAYIMFFELDLSQAAS 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USP3NP_006528.2 zf-UBP 29..105 CDD:307999
UCH 159..508 CDD:306860 105/356 (29%)
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 105/356 (29%)
UCH 172..477 CDD:278850 105/356 (29%)
Asp-B-Hydro_N <617..>731 CDD:191249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.