DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXSR1 and hpo

DIOPT Version :9

Sequence 1:XP_011532633.1 Gene:OXSR1 / 9943 HGNCID:8508 Length:580 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:486 Identity:152/486 - (31%)
Similarity:218/486 - (44%) Gaps:96/486 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    77 GSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDEL 141
            |.|:...|   |.|..||..:|..|.|...::.:.|::|||..|.||..|.:|.||.|:..:.:|
  Fly    49 GEGSYGSV---YKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQYDL 110

Human   142 WLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKNGQIHRDVKAGNIL 206
            |:.|:....|||.||::       .:...|.|..|||||.:.|:||.|||...:||||:||.|||
  Fly   111 WICMEYCGAGSVSDIMR-------LRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANIL 168

Human   207 LGEDGSVQIADFGVSAFLATGGDITRNKV-RKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITA 270
            |..:|..::|||||:      |.:|.... |.|.:|||.||||||:|:: |||..|||||.||||
  Fly   169 LNTEGYAKLADFGVA------GQLTDTMAKRNTVIGTPFWMAPEVIEEI-GYDCVADIWSLGITA 226

Human   271 IELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTA 335
            :|:|.|..||.:..||:.:.:..|..|||....       .::...|...:|.||.|:|:.|.||
  Fly   227 LEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREP-------DRWSTEFIDFVSKCLVKEPDDRATA 284

Human   336 AELLRHKFFQKAKNKEFLQEKTLQRAPTISERAKKVRRVPG----SSGRLHKTEDGGWEW--SDD 394
            .|||.|:|.:.||::..| :..|:....|.|:.:..|...|    |..:...|::.|.:.  :|:
  Fly   285 TELLEHEFIRNAKHRSIL-KPMLEETCAIREQQRANRSFGGVLAASQAKSLATQENGMQQHITDN 348

Human   395 EFDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQV 459
            .|.|                              || |||  |||:...:....|       :..
  Fly   349 AFME------------------------------DP-GTL--VPEKFGEYQQSSA-------SDA 373

Human   460 SLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISA 524
            ::...||.......|..|.              |||..|          .....|...:...:..
  Fly   374 TMIAHAEQGVDEGTLGPGG--------------LRNLSK----------AAAPAAASSAASPLDM 414

Human   525 GLVDGRDLVIVAANLQKIVEEPQSNRSVTFK 555
            ..||...:|.:.:||..:|....|:.|.|.|
  Fly   415 PAVDSGTMVELESNLGTMVINSDSDDSTTAK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXSR1XP_011532633.1 STKc_OSR1_SPAK 77..344 CDD:270787 109/267 (41%)
S_TKc 77..344 CDD:214567 109/267 (41%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 109/267 (41%)
S_TKc 42..293 CDD:214567 109/267 (41%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.