DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM8A and tsu

DIOPT Version :9

Sequence 1:NP_005096.1 Gene:RBM8A / 9939 HGNCID:9905 Length:174 Species:Homo sapiens
Sequence 2:NP_610454.2 Gene:tsu / 35924 FlyBaseID:FBgn0033378 Length:165 Species:Drosophila melanogaster


Alignment Length:168 Identity:106/168 - (63%)
Similarity:129/168 - (76%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGD--- 62
            ||||||:..|  |:|.:|||||:.|.:||||||.||||||||:..:|..: ..|:.|..:.|   
  Fly     1 MADVLDIDNA--EEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAI-HSYERVRNEDDDEL 62

Human    63 EPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEA 127
            ||||||||||||||||.:||||.|::|.:||.:||||||||||||||||:.|||.||||||:|:|
  Fly    63 EPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQA 127

Human   128 QAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRR 165
            .||.|.|||.::|||.|.||||||:||.:.|:...|||
  Fly   128 LAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM8ANP_005096.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 39/71 (55%)
RRM_RBM8 67..151 CDD:409762 61/83 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 7/15 (47%)
tsuNP_610454.2 PBP2_NikA_DppA_OppA_like 10..>80 CDD:413028 43/72 (60%)
RRM_RBM8 67..154 CDD:409762 63/86 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159763
Domainoid 1 1.000 108 1.000 Domainoid score I6481
eggNOG 1 0.900 - - E1_KOG0130
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3744
Inparanoid 1 1.050 214 1.000 Inparanoid score I3635
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004710
OrthoInspector 1 1.000 - - oto89675
orthoMCL 1 0.900 - - OOG6_102283
Panther 1 1.100 - - LDO PTHR45894
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1829
SonicParanoid 1 1.000 - - X3311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.