DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAFB and maf-S

DIOPT Version :9

Sequence 1:NP_005452.2 Gene:MAFB / 9935 HGNCID:6408 Length:323 Species:Homo sapiens
Sequence 2:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster


Alignment Length:122 Identity:52/122 - (42%)
Similarity:73/122 - (59%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   182 QLPTSHPGPGPHATASATAAGGNGSVEDRFSDDQLVSMSVRELNRHL--RGFTKDEVIRLKQKRR 244
            |.|.| |.|.|..|                 ||.|||:|||:|||.|  ||..::|::|:||:||
  Fly    16 QAPLS-PCPIPDIT-----------------DDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRR 62

Human   245 TLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKL 301
            ||||||||.|||.||::||..||.:|:....::||:.::..::.||...:|.|.:.|
  Fly    63 TLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKAL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAFBNP_005452.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..78
Maf_N 81..113 CDD:400609
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..210 7/27 (26%)
bZIP_Maf_large 233..302 CDD:269866 31/69 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 238..263 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 266..287 5/20 (25%)
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 59..110 CDD:269865 25/50 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395389at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5055
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.