DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARNT2 and cyc

DIOPT Version :9

Sequence 1:NP_055677.3 Gene:ARNT2 / 9915 HGNCID:16876 Length:717 Species:Homo sapiens
Sequence 2:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster


Alignment Length:408 Identity:167/408 - (40%)
Similarity:249/408 - (61%) Gaps:36/408 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    51 DFDDEDGEGPSKFSR-ENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMK 114
            ::|:|.....|..:| :||||||:|||:||..||.|||.|:|.|.|:.||.||||:|||||.|::
  Fly    17 NYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMCFAMQRKLDKLTVLRMAVQHLR 81

Human   115 SMRGTGN----KSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQ 175
            .:||:|:    ..:|  |:||||::||||.:||:|::||||||..:.||::||||||:.|||..|
  Fly    82 GIRGSGSLHPFNGSD--YRPSFLSDQELKMIILQASEGFLFVVGCDRGRILYVSDSVSSVLNSTQ 144

Human   176 SEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTG-TVKKEGQQSSMRMCMGSRRSFIC 239
            ::..|.:.::.:||.|:.|::|||.:.|.....|::|.||. .||.:..||..|:|.|:||||.|
  Fly   145 ADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLIDAKTMLPVKTDVPQSLCRLCPGARRSFFC 209

Human   240 RMRCGNA-------PLDHLPLNRITTMRK-RFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTI 296
            ||:...|       ..|....:|.:|.|| |...|        .:|.|:.||||:|:|.|    |
  Fly   210 RMKLRTASNNQIKEESDTSSSSRSSTKRKSRLTTG--------HKYRVIQCTGYLKSWTP----I 262

Human   297 PEEDADVGQGSK----YCLVAIGRL--QVTSS--PVCMDMNGMSVPTEFLSRHNSDGIITFVDPR 353
            .:||.|.....:    .|||||||:  .|.:|  |..:|.:.......|:|||:.:|...|:|.|
  Fly   263 KDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHPNIRHVLFISRHSGEGKFLFIDQR 327

Human   354 CISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSF 418
            ...|||:.||::||....|:.|.||.:.|.||.:.|:::..:|.:.:||||.|:..::.:::...
  Fly   328 ATLVIGFLPQEILGTSFYEYFHNEDIAALMESHKMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWR 392

Human   419 TFQNPYSDEIEYIICTNT 436
            .|:||::.||:|||..|:
  Fly   393 AFKNPWTSEIDYIIAKNS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARNT2NP_055677.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..74 10/23 (43%)
bHLH-PAS_ARNT 62..124 CDD:381517 36/66 (55%)
PAS 137..243 CDD:395786 51/106 (48%)
PAS_11 336..436 CDD:405306 37/99 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..717
cycNP_524168.2 HLH 31..84 CDD:278439 33/52 (63%)
PAS 111..212 CDD:279347 47/100 (47%)
PAS 111..173 CDD:214512 29/61 (48%)
PAS_11 311..411 CDD:291273 38/100 (38%)
PAS 311..406 CDD:238075 35/94 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168098at33208
OrthoFinder 1 1.000 - - FOG0000695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.