Sequence 1: | XP_011522403.1 | Gene: | SGSM2 / 9905 | HGNCID: | 29026 | Length: | 1103 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001162808.1 | Gene: | GstT3 / 33047 | FlyBaseID: | FBgn0031117 | Length: | 268 | Species: | Drosophila melanogaster |
Alignment Length: | 244 | Identity: | 53/244 - (21%) |
---|---|---|---|
Similarity: | 79/244 - (32%) | Gaps: | 83/244 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 271 IRKRHSSGSASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESL 335
Human 336 TLKWTPNQLMNGTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQK---SGGTLVLVSQDGIQRPP 397
Human 398 LH--------------FPQGGHLLSFLSC-----------LENGLLP--------RGQLEPPL-- 427
Human 428 ----WTQQGKGKVFPKLRKRSSIRSVDME---EMGTGRATDYVFRIIYP 469 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SGSM2 | XP_011522403.1 | RUN | 90..235 | CDD:280855 | |
PH_RUTBC | 302..470 | CDD:275431 | 45/213 (21%) | ||
TBC | <885..1053 | CDD:214540 | |||
GstT3 | NP_001162808.1 | GST_N_Theta | 45..121 | CDD:239348 | 20/105 (19%) |
GstA | 47..243 | CDD:223698 | 48/224 (21%) | ||
GST_C_Theta | 135..259 | CDD:198292 | 26/104 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |