DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM19 and CG3594

DIOPT Version :10

Sequence 1:NP_057280.2 Gene:RBM19 / 9904 HGNCID:29098 Length:960 Species:Homo sapiens
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:199 Identity:60/199 - (30%)
Similarity:89/199 - (44%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   682 KDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEEEEE--------EESLPGCT------L 732
            ::|::||   |.::.::....:|.|...||....||||..|.        ...|.|.:      |
  Fly    55 RNPSDPE---DSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVL 116

Human   733 FIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGH 797
            ::.||||:||::.|:..||..|||||..|.||:..       ||.|||.......|.|. ||...
  Fly   117 YVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRRG-------GFAFVEMADLSSFQNAF-QLHNT 173

Human   798 VVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRELFSTFGELKTVR 862
            .:.|..::|:|||...|.:   |.||.: .||...|:        |..|..::.|:..|:.....
  Fly   174 ELQGRNIKVQISEAGKKKS---ANKKN
I-IKQKNRKL--------AEMRNEQKTFTKSGKFYDKD 226

Human   863 LPKK 866
            |.|:
  Fly   227 LKKE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM19NP_057280.2 RRM1_RBM19 2..77 CDD:409980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..294
RRM2_RMB19 294..365 CDD:409925
RRM3_RBM19 400..478 CDD:409983
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..513
RRM4_RBM19 587..658 CDD:409984
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..729 14/54 (26%)
RRM5_RBM19_like 730..809 CDD:409757 29/84 (35%)
RRM6_RBM19 832..910 CDD:409985 7/35 (20%)
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 50/155 (32%)
RRM 116..187 CDD:440488 31/78 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.