DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fibcd1 and CG31832

DIOPT Version :9

Sequence 1:NP_849218.2 Gene:Fibcd1 / 98970 MGIID:2138953 Length:459 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:227 Identity:88/227 - (38%)
Similarity:123/227 - (54%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse   230 PRGCANGSRPRDCLDVLLSGQQDDGVYSI-FPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNF 293
            |..|.:||              .:|::.: .|...|  ||| ...:|....|.|.|||.||||||
  Fly    22 PHTCPSGS--------------PNGIHQLMLPEEEP--FQV-TQCKTTARDWIVIQRRLDGSVNF 69

Mouse   294 FRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPE 358
            .:.|.:|::|||...||.::||::::.:|.:..:||.:.|:.....|.|||:..     |.||.|
  Fly    70 NQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDD-----FQVDSE 129

Mouse   359 EDGYPL-TVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYL 422
            .:.|.| .|..|||||||||..|...||:|.|||:|.|..||||.:.|.||:.:|.:|:|||.|.
  Fly   130 TELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYF 194

Mouse   423 RGAHASYADGVEWSSWTGWQYSLKFSEMKIRP 454
            |.......:|:.|..|. :| ||.|.::.|||
  Fly   195 REGETGMLNGIHWGRWK-FQ-SLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fibcd1NP_849218.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
FReD 239..455 CDD:238040 84/218 (39%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 86/221 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.