DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLPPR4 and CG11425

DIOPT Version :9

Sequence 1:NP_055654.3 Gene:PLPPR4 / 9890 HGNCID:23496 Length:715 Species:Homo sapiens
Sequence 2:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster


Alignment Length:341 Identity:90/341 - (26%)
Similarity:139/341 - (40%) Gaps:71/341 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    20 PCFYFVELPILASSVVSLYFLELTDVFK-----PVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLS 79
            |....|:|.:|...:|      |.:.|:     |...||.|.|.||..||.|.|   :...:|..
  Fly    10 PIRLLVDLVLLGLLIV------LVENFRRLWGPPTKRGFFCDDESLMYPYHENT---VSPTLLHW 65

Human    80 LAFAGPAITIMVGEGILYCCLSKRRNGV---GLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCST 141
            |....|.|:::|.|..    ||.|::..   .|.|..|            .||:   .::|..|.
  Fly    66 LGLYLPLISLVVLESF----LSHRKDMAPWPTLWPVYN------------TVRW---FLYGYVSN 111

Human   142 ALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKENS------YIVEDIC----SGSDLTVINSG 196
            .|:..|.:.:.|...|:|..||.|::.. ..||.:.|      |..:..|    |.:...:|...
  Fly   112 DLLKGIGKQALGRLRPHFFAVCSPHFPD-GSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDV 175

Human   197 RKSFPSQHATLAAFAAVYVSMYFNS---TLTDSSKLLKPLLVFTFIICGIICGLTRITQYKNHPV 258
            ..||||.|:.:|.:..|:|:::...   .|..|  ||.|:|....:.......::|:..||:|..
  Fly   176 NVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGS--LLSPVLQLACVALAWFVAISRVIDYKHHWS 238

Human   259 DVYCGFLIGGGIALYLGLYAVGNFLPSDESMFQHRDALRSLTDLNQDPNRLLSAKNGSSSDGIAH 323
            ||..|.|:|.|.||     ||.....|:|..::.:|:             |.|||..::...:|.
  Fly   239 DVAAGSLLGAGSAL-----AVTRAAASEELQWRCQDS-------------LASAKQEAAVVDVAD 285

Human   324 TEGILNRNHRDASSLT 339
            .:|.....| |.|.:|
  Fly   286 VKGGQQMPH-DLSLVT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLPPR4NP_055654.3 PAP2_wunen 126..275 CDD:239479 45/161 (28%)
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 48/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144647
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.