DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB39 and CG10321

DIOPT Version :9

Sequence 1:NP_055645.1 Gene:ZBTB39 / 9880 HGNCID:29014 Length:712 Species:Homo sapiens
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:654 Identity:117/654 - (17%)
Similarity:205/654 - (31%) Gaps:159/654 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   123 PDLESTARAKPLTSTSESHSGTLSCPSAEPAHPLGELRGGGDYLGADRNYVLP------------ 175
            |.::......|...|.:.....:..|:.:|| |...|...|......:..:||            
  Fly   177 PQMQLMQEHAPQQPTMQQQIQQIHMPTLQPA-PAQLLSAAGATTTMPQQILLPNGQLITTAQIVA 240

Human   176 ---SDAGGSYKEEEKNVASDANHSLHLPQ--PPPPPPKTEDHDTPAPFTSIPSMMTQPLLGTVST 235
               :....:..:...|..:.|..|..|||  ..|.....:....|....::..:...|......|
  Fly   241 PQLAQIISTAPQSTTNGQATAAQSQFLPQLLQTPNGQTLQIVQQPNGTQTLQLVQLVPQRSLAPT 305

Human   236 GIQTSTSS-------------------------CQP---------YKVQSNGDFS-KNSFLTPDN 265
            |:.|.|::                         |:.         .::.|..|.| :...|..|.
  Fly   306 GVTTVTTTTNATDMGQHVGASLGDADVQLLEDGCEVEDEELEDVYEQLDSKADHSFETIVLDDDQ 370

Human   266 AVDITTG--------TNSCLSNSEHSKDPGFGQMDELQLEDLGDDDLQFEDPAEDIGT-TEEVIE 321
            ..|....        .|..|:.||......|..:|:.|..|..:|:.:...|.||..| ..|.|:
  Fly   371 QQDFLKDHHEHHQVMINEDLTQSESQDHEYFDDLDQQQAMDEIEDEEEQMKPEEDQDTFIIEEIQ 435

Human   322 LSDDSEDELAFGENDNRENKAMPCQVCKKVLEPNIQ-----------LIRQHARDHVDLLTGNCK 375
            |.||...:...||..:::     |:...:..:|::.           :........||:......
  Fly   436 LEDDEMLDDPDGEEIDQD-----CEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFMD 495

Human   376 VCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTL----------HRRDGIFENNIIV 430
            ..::|.|.....:..:.....:..||.....|:......:|:          .|.:......:.:
  Fly   496 SEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPKRAKRSNHQIPAGVTL 560

Human   431 HPNDPLPGKLGLFSGAASPELKCAACGKVLAKDFHVVRGHILDHLNLKGQACSVCDQRH---LNL 492
            .|.|..|..    :|:.:.....||..:.|.:...|:             |.:..|..:   .||
  Fly   561 EPCDHQPPA----AGSTTSSKLAAANSRQLVQTASVI-------------AAAGADDNYEIDANL 608

Human   493 CS--LMWHTLSHLGISVFSCSVCANSFVDWHLLEKHMAVHQSLEDALF----HCRLCSQSFKSEA 551
            .:  :..|| |.||...:.|.:|:..|..:..|:.||..|.:...|..    .|::|.:|||...
  Fly   609 VTEFIRQHT-SPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPG 672

Human   552 AYRYHVSQHKCNSGLDARPGFGLQHPALQKRKLPAEEFLGEELALQGQPGNSKYSCKVCGKRFAH 616
            ..|.|:..|...|                                      |...|.:|.:.|..
  Fly   673 MLRMHMKTHDAES--------------------------------------STPMCTICNRTFKS 699

Human   617 TSEFNYHRRIHTGEKPYQCKV--CHKFFRGRSTIKCHL-KTHSGAL--MYRCTVCGHYSSTLNLM 676
            .:....||:.|. ::.|.|.|  |.|.|.....:|.|: :.|...:  :::|..||.....::.:
  Fly   700 KAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSL 763

Human   677 SKHV 680
            ..||
  Fly   764 QLHV 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB39NP_055645.1 BTB 20..119 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..162 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..224 8/49 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..260 7/58 (12%)
C2H2 Zn finger 453..474 CDD:275368 4/20 (20%)
C2H2 Zn finger 482..502 CDD:275368 5/24 (21%)
C2H2 Zn finger 510..530 CDD:275368 6/19 (32%)
C2H2 Zn finger 540..560 CDD:275368 7/19 (37%)
C2H2 Zn finger 607..627 CDD:275368 5/19 (26%)
zf-H2C2_2 619..643 CDD:316026 8/25 (32%)
C2H2 Zn finger 635..655 CDD:275368 7/22 (32%)
C2H2 Zn finger 663..683 CDD:275368 5/18 (28%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 21/115 (18%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 7/19 (37%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 7/22 (32%)
C2H2 Zn finger 750..767 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.