DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLK1 and TPK1

DIOPT Version :9

Sequence 1:NP_036422.3 Gene:TLK1 / 9874 HGNCID:11841 Length:766 Species:Homo sapiens
Sequence 2:NP_012371.2 Gene:TPK1 / 853275 SGDID:S000003700 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:86/317 - (27%)
Similarity:139/317 - (43%) Gaps:54/317 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   410 LKKEEAEIQAELERLERVRNLHIRELKRINNEDNSQFKDHPTLN------ERYLLLHLLGRGGFS 468
            ::||..|.|      |:.:..|:   ...|.|...||.....:.      :.:.:|..||.|.|.
Yeast    44 VEKEGGETQ------EKPKQPHV---TYYNEEQYKQFIAQARVTSGKYSLQDFQILRTLGTGSFG 99

Human   469 EVYKAFDLYEQRYAAVKIHQLNKSWRDEKKE-----NYHKHACREYRIHKELDHPRIVKLYDYFS 528
            .|:.....:..||.|:|:         .|||     ...:|...|..:...:.||.|::::..|.
Yeast   100 RVHLIRSRHNGRYYAMKV---------LKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQ 155

Human   529 LDTDTFCTVLEYCEGNDLDFYLKQHKLMSEKEARSIVMQIVNALRYLNEIKPPIIHYDLKPGNIL 593
             |......:::|.||.:|...|::.:......|:....::..||.||:  ...||:.||||.|||
Yeast   156 -DAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH--SKDIIYRDLKPENIL 217

Human   594 LVDGTACGEIKITDFGLSKIMDDDSYGVDGMDLTSQGAGTYWYLPPECFVVGKEPPKISNKVDVW 658
            |...   |.|||||||.:|.:.|.:|.:         .||..|:.||  ||..:|  .:..:|.|
Yeast   218 LDKN---GHIKITDFGFAKYVPDVTYTL---------CGTPDYIAPE--VVSTKP--YNKSIDWW 266

Human   659 SVGVIFFQCLYGRKPFGHNQSQQDILQENTILKATEVQFPVKPVVSSEAKAFIRRCL 715
            |.|::.::.|.|..||..:.:.:..   ..||.| |::||  |..:.:.|..:.|.:
Yeast   267 SFGILIYEMLAGYTPFYDSNTMKTY---EKILNA-ELRFP--PFFNEDVKDLLSRLI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLK1NP_036422.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..197
Smc 209..>454 CDD:224117 10/49 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..383
STKc_TLK1 449..747 CDD:270942 76/278 (27%)
TPK1NP_012371.2 STKc_PKA_like 85..375 CDD:270732 76/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.