DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TOMM70 and CG1847

DIOPT Version :9

Sequence 1:	NP_055635.3	Gene:	TOMM70 / 9868	HGNCID:	11985	Length:	608	Species:	Homo sapiens
Sequence 2:	NP_001368980.1	Gene:	CG1847 / 32144	FlyBaseID:	FBgn0030345	Length:	390	Species:	Drosophila melanogaster

Alignment Length:	124	Identity:	31/124 - (25%)
Similarity:	50/124 - (40%)	Gaps:	51/124 - (41%)

- Green bases have known domain annotations that are detailed below.

Human   118 KNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQL--------QKWKEVA- 173
            :.:||.::||.::.:|..||.||:.:                   .|||        ::|:|:|
  Fly   175 RERGNNFYKASRFTEAETCYREAVGI-------------------VEQLMLKEKPHDEEWQELAA 220

Human   174 -----------------------QDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLED 209
                                   :.|.:.:.|:|:.|||||||||||....|..:...|
  Fly   221 IKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRD 279

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TOMM70	NP_055635.3	3a0801s09	41..601	CDD:273380	31/124 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	67..107
		TPR 1	114..147		9/28 (32%)
		TPR repeat	114..142	CDD:276809	9/23 (39%)
		TPR repeat	152..182	CDD:276809	7/61 (11%)
		TPR 2	153..186		9/64 (14%)
		TPR 3	294..327
		TPR 4	329..362
		TPR repeat	329..357	CDD:276809
		TPR repeat	362..396	CDD:276809
		TPR 5	367..400
		TPR 6	401..434
		TPR repeat	401..429	CDD:276809
		TPR repeat	435..470	CDD:276809
		TPR 7	440..475
		TPR 8	476..509
		TPR repeat	476..504	CDD:276809
		TPR repeat	509..540	CDD:276809
		TPR 9	511..544
		TPR 10	545..578
		TPR repeat	545..572	CDD:276809
CG1847	NP_001368980.1	FKBP_C	23..>92	CDD:395196
		3a0801s09	150..>308	CDD:273380	31/124 (25%)
		TPR repeat	173..217	CDD:276809	13/60 (22%)
		TPR repeat	222..252	CDD:276809	1/29 (3%)
		TPR repeat	257..285	CDD:276809	13/23 (57%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1535
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940