DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PJA2 and CG4325

DIOPT Version :9

Sequence 1:	NP_055634.3	Gene:	PJA2 / 9867	HGNCID:	17481	Length:	708	Species:	Homo sapiens
Sequence 2:	NP_001259169.1	Gene:	CG4325 / 31167	FlyBaseID:	FBgn0026878	Length:	158	Species:	Drosophila melanogaster

Alignment Length:	42	Identity:	16/42 - (38%)
Similarity:	22/42 - (52%)	Gaps:	0/42 - (0%)

- Green bases have known domain annotations that are detailed below.

Human   634 CPICCSEYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCR 675
            |.||...:...|......|.|.||:.|:..|.::|.|||:||
  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR 49

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PJA2	NP_055634.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..31
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	53..90
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	244..317
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	425..495
		Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000269\|PubMed:21423175	531..708		16/42 (38%)
		zf-RING_2	634..675	CDD:290367	14/40 (35%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	685..708
CG4325	NP_001259169.1	zf-RING_2	8..49	CDD:290367	14/40 (35%)
CG4325	NP_001259169.1	Prefoldin	112..>151	CDD:298833
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910