DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIL and Toll-7

DIOPT Version :9

Sequence 1:NP_055632.2 Gene:TRIL / 9865 HGNCID:22200 Length:811 Species:Homo sapiens
Sequence 2:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster


Alignment Length:365 Identity:107/365 - (29%)
Similarity:170/365 - (46%) Gaps:39/365 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    34 QHPQHLLCTNRGLRVVPKT---------------------SSLPSPHDVLTYSLGGNFITNIT-A 76
            |.|...||....|:|:..|                     .|..|...||..|  .|.:.:|: :
  Fly   203 QLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNCGAGSGSAGSELQVLDAS--HNELRSISES 265

Human    77 FDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAPGTLAPLRKLRILYANGN 141
            :...||.:|:.|:|.||.:..|..:....|:.|..:.|.||.|:.|..|..|..::||.::...|
  Fly   266 WGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQN 330

Human   142 EISRLSRGSFEGLESLVKLRLDGNALGA--LPDAVFAPLGNLLYLHLESNRIRFLGKNAFAQLGK 204
            |:..|.:|.|..||.|:.:.|.||.|.:  :.:..||.|..|:.|:|..|.:..:....|.:|..
  Fly   331 ELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYF 395

Human   205 LRFLNLSANELQPSLRHAA--TFAPLRSLSSLILSANNLQHLGPRIFQHLPRLGLLSLRGNQLTH 267
            |:.|||..|    |:.|..  .|.||.:|.:|.|:.|.|..|..::|..|..|..|:|..|.::.
  Fly   396 LQILNLRNN----SIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISV 456

Human   268 LAPEAFWGLEALRELRLEGNRLSQLPTALLEPLHSLEALDLSGNELSALHPATFGHLGRLRELSL 332
            :.|..|.....|:||.|..|:|:::|.| |:.|..|..|||..|::......:|.:|.:|..|.|
  Fly   457 VEPAVFKNCSDLKELDLSSNQLNEVPRA-LQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRL 520

Human   333 RNNALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKR 372
            .:|.:..::..:|...|.|..|:|..|      |::.::|
  Fly   521 IDNQIGNITVGMFQDLPRLSVLNLAKN------RIQSIER 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRILNP_055632.2 LRR_RI <2..194 CDD:238064 52/183 (28%)
leucine-rich repeat 37..61 CDD:275380 7/44 (16%)
LRR 1 61..81 5/20 (25%)
leucine-rich repeat 62..84 CDD:275380 6/22 (27%)
LRR_8 84..143 CDD:290566 18/58 (31%)
LRR 2 84..105 6/20 (30%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
LRR 3 108..129 7/20 (35%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR 4 132..153 7/20 (35%)
leucine-rich repeat 133..156 CDD:275380 8/22 (36%)
LRR_8 156..215 CDD:290566 19/60 (32%)
LRR 5 156..177 6/22 (27%)
leucine-rich repeat 157..180 CDD:275380 8/24 (33%)
LRR 6 180..201 5/20 (25%)
leucine-rich repeat 181..204 CDD:275380 6/22 (27%)
LRR 7 204..223 7/18 (39%)
leucine-rich repeat 205..254 CDD:275380 18/50 (36%)
LRR 8 230..251 7/20 (35%)
LRR_8 239..289 CDD:290566 16/49 (33%)
LRR_RI <249..>364 CDD:238064 35/114 (31%)
LRR 9 254..275 6/20 (30%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
LRR 10 278..299 9/20 (45%)
LRR_8 279..337 CDD:290566 21/57 (37%)
leucine-rich repeat 279..302 CDD:275380 10/22 (45%)
LRR 11 302..323 6/20 (30%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
LRR 12 326..347 5/20 (25%)
leucine-rich repeat 327..346 CDD:275380 4/18 (22%)
leucine-rich repeat 351..363 CDD:275378 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..549
fn3 589..667 CDD:278470
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566 13/57 (23%)
leucine-rich repeat 191..214 CDD:275380 4/10 (40%)
leucine-rich repeat 215..248 CDD:275380 4/32 (13%)
LRR_RI 247..501 CDD:238064 85/260 (33%)
LRR_8 247..308 CDD:290566 19/62 (31%)
leucine-rich repeat 249..273 CDD:275380 7/25 (28%)
leucine-rich repeat 274..297 CDD:275380 7/22 (32%)
LRR_8 297..356 CDD:290566 21/58 (36%)
leucine-rich repeat 298..321 CDD:275380 8/22 (36%)
leucine-rich repeat 322..345 CDD:275380 8/22 (36%)
LRR_8 345..406 CDD:290566 19/64 (30%)
leucine-rich repeat 346..371 CDD:275380 8/24 (33%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 10/26 (38%)
LRR_8 419..478 CDD:290566 19/58 (33%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRR_RI 466..622 CDD:238064 29/96 (30%)
leucine-rich repeat 468..488 CDD:275380 9/20 (45%)
LRR_8 491..549 CDD:290566 17/63 (27%)
leucine-rich repeat 491..514 CDD:275380 7/22 (32%)
leucine-rich repeat 515..536 CDD:275380 5/20 (25%)
leucine-rich repeat 539..562 CDD:275380 6/22 (27%)
leucine-rich repeat 563..585 CDD:275380
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.