DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FARP2 and shk2

DIOPT Version :9

Sequence 1:XP_011510535.1 Gene:FARP2 / 9855 HGNCID:16460 Length:1061 Species:Homo sapiens
Sequence 2:NP_592864.1 Gene:shk2 / 2541468 PomBaseID:SPAC1F5.09c Length:589 Species:Schizosaccharomyces pombe


Alignment Length:124 Identity:31/124 - (25%)
Similarity:57/124 - (45%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   940 SGY-LLRKFKNSH-GWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVF 1002
            ||: :|::.|..: .|.|.|:|.::..|..||..:.:....:| ||.....:.|...   :.:.|
pombe    27 SGWVMLKEDKMKYLPWTKKWLVLSSNSLSIYKGSKSESAQVTL-LLKDIQKVERSKS---RTFCF 87

Human  1003 KLQFKSHVYFFR--------AESKYTFERWMEVIQGASSSAGRAPSIVQDGPQPSSGLE 1053
            ||:|||....|.        |::...:| ||::| .:.:.|.:..|.:....|...|::
pombe    88 KLRFKSSTKNFEIQACELSVADNMECYE-WMDLI-SSRALASKVSSPMNPKHQVHVGID 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FARP2XP_011510535.1 B41 45..234 CDD:214604
FERM_C_FARP1-like 221..341 CDD:270014
FA 333..375 CDD:312314
Herpes_ICP4_C 358..>533 CDD:332854
RhoGEF 537..720 CDD:238091
PH1_FARP1-like 749..862 CDD:269928
PH2_FARP1-like 935..1032 CDD:270055 27/101 (27%)
shk2NP_592864.1 PH_Cla4_Ste20 24..120 CDD:270097 26/97 (27%)
PBD 128..182 CDD:279166 3/17 (18%)
STKc_PAK 308..567 CDD:270789
S_TKc 309..566 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.