DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB24 and CG3281

DIOPT Version :9

Sequence 1:NP_055612.2 Gene:ZBTB24 / 9841 HGNCID:21143 Length:697 Species:Homo sapiens
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:409 Identity:102/409 - (24%)
Similarity:167/409 - (40%) Gaps:124/409 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   107 EQILATAQFLKVYDLVKAYTDFQNNHSSPKPTTLNT-AGAPVVVISNKKNDPPK---RKRGRPKK 167
            :.:::.||:|.. ...:.:.:.:..:.....:...: .|...:..|..::|.|:   :.:.||.:
  Fly   116 DDVVSMAQYLST-SFAEQHVEMEEKYGDQDCSAFTSDVGEEPLYASEDRDDEPEDSFQLKPRPDE 179

Human   168 VNTLQEEKSELAAEEEIQLRVNNSVQNRQNFVVK------------------GDSGVLNEQIAA- 213
            :     |..||:...::..|:|:|.    ||:.|                  ..:..|...:|| 
  Fly   180 I-----ENRELSRPSQLGSRLNHSA----NFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAM 235

Human   214 KEKEES----EPTCEPSREEEMPVEKDENYDPKTEDGQASQSRYSKRRIWRSVKLKDYKLVGDQE 274
            |...||    ..|||              :.|:|...|.:..|:.:.....::.|:.    .:..
  Fly   236 KLANESCGTGLLTCE--------------HCPRTFKRQDTLRRHMQAFHPDAIALEP----EETT 282

Human   275 DHGSAKRICGRRKRPGGPEARCKDCGKVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQV 339
            |:.:.|||..||.        |..||..|..:. |.||.|.|||:.|:||::|.|.|.:...|.:
  Fly   283 DNSARKRIAKRRD--------CPHCGLSFPVSS-LTIHIRRHTGDNPYKCDQCEKAFPRSQDLSL 338

Human   340 HTRMHTGERPYTCTVCSKALTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHYRVHTGHS 404
            |.|.||||||..|.:|||                           |:.|||:             
  Fly   339 HMRQHTGERPSECKICSK---------------------------KFISQNK------------- 363

Human   405 LPECKDCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGK 469
                            |.:|:|.|||::|::|::|.|||...:.|:.|:|.|.||:||.||:||:
  Fly   364 ----------------LARHMRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGE 412

Human   470 SFSDSSAKRRHCILHTGKK 488
            ||...|    |..:|..:|
  Fly   413 SFVCGS----HLNIHRNRK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB24NP_055612.2 BTB 27..133 CDD:306997 3/25 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..176 7/48 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..254 12/49 (24%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
COG5048 <321..480 CDD:227381 50/158 (32%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 4/19 (21%)
C2H2 Zn finger 380..400 CDD:275368 4/19 (21%)
C2H2 Zn finger 408..428 CDD:275368 3/19 (16%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
C2H2 Zn finger 464..480 CDD:275368 7/15 (47%)
C2H2 Zn finger 492..512 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..697
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 0/20 (0%)
C2H2 Zn finger 249..266 CDD:275368 6/30 (20%)
COG5048 <294..>391 CDD:227381 47/161 (29%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 12/23 (52%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 13/49 (27%)
C2H2 Zn finger 351..371 CDD:275368 11/75 (15%)
zf-H2C2_2 364..388 CDD:290200 12/23 (52%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 14/24 (58%)
C2H2 Zn finger 407..424 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.