DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB24 and Clamp

DIOPT Version :9

Sequence 1:NP_055612.2 Gene:ZBTB24 / 9841 HGNCID:21143 Length:697 Species:Homo sapiens
Sequence 2:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster


Alignment Length:434 Identity:115/434 - (26%)
Similarity:179/434 - (41%) Gaps:93/434 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   172 QEEKSELAAEEEIQLRVNNSVQNRQNFVVKGDSGVLNEQIAAKEKEESEPTCEPSREEEMPVEKD 236
            |::.:..|..:.|.:.....:...||.:..|..|.:  ||.      |..|.||.::..|..::.
  Fly   157 QQQHNAQAGGDSIAVVSAQGLVQAQNIIGNGQMGQI--QIV------SSDTLEPVQQSVMQQQQH 213

Human   237 ENYDPKTEDGQASQSRYSKRRIWRSVKLKD----------------------------------- 266
            |:...|..:..:|..:.|||:..:.|:.:.                                   
  Fly   214 ESKASKCINCGSSMLQQSKRKGPKQVRCESCMQAEQTAQQQQQLFVAQDGQMAHPVQIISTTPQA 278

Human   267 ----YKLVGDQEDHGSAKRICGR-------RKRPGGPEARCKDCGKVFKYNHFLAIHQRSHTGER 320
                .::|..|....:.||....       :||......:|:.|..    :..:.:.|.||    
  Fly   279 QAQLQQIVAAQTGGTTPKREASSGSGHHPVKKRNSQQMTKCQKCNG----SGVVLVGQHSH---- 335

Human   321 PFKCNECGKGFAQKHSLQVHTR---MHTGERPYTCTVCSKALTTKHSLLEHMSLHSGQKSFTCDQ 382
               .:..|.|.:.|.|:.|.|.   .....:|::|.:|....:...||..|..||||:|::.|..
  Fly   336 ---ASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSI 397

Human   383 CGKYFSQNRQLKSHYRVHTGHSLPECKDCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKS 447
            ||..|::...||:|.|:|||....:|:.|..:|.....||.|.|||:||:|:.|.:|.|.|...:
  Fly   398 CGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHA 462

Human   448 SLQTHIRIHRGEKPYSCGICGKSFSDSSAKRRHCILHTGKKPFSCPECNLQFARLDNLKAHLKIH 512
            :|..|.|||.|||||.|.|||.:||.::..:.|..:|:|:||:.|..|:..||....||.|..||
  Fly   463 TLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIH 527

Human   513 SKEKHASDASSISGSSNTEEVRNILQLQPYQLSTSG----EQEI 552
            .|..                     |..|.|.|:.|    :|||
  Fly   528 QKYG---------------------QTAPRQTSSDGMIVHKQEI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB24NP_055612.2 BTB 27..133 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..176 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..254 10/44 (23%)
C2H2 Zn finger 296..316 CDD:275368 3/19 (16%)
COG5048 <321..480 CDD:227381 60/161 (37%)
C2H2 Zn finger 324..344 CDD:275368 6/22 (27%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
C2H2 Zn finger 380..400 CDD:275368 8/19 (42%)
C2H2 Zn finger 408..428 CDD:275368 7/19 (37%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
C2H2 Zn finger 464..480 CDD:275368 6/15 (40%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..697
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 55/138 (40%)
C2H2 Zn finger 367..387 CDD:275368 5/19 (26%)
zf-H2C2_2 379..403 CDD:290200 11/23 (48%)
C2H2 Zn finger 395..415 CDD:275368 8/19 (42%)
zf-H2C2_2 407..432 CDD:290200 10/24 (42%)
C2H2 Zn finger 423..443 CDD:275368 7/19 (37%)
zf-H2C2_2 435..460 CDD:290200 13/24 (54%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
zf-H2C2_2 464..488 CDD:290200 15/23 (65%)
COG5048 475..>529 CDD:227381 23/53 (43%)
C2H2 Zn finger 479..499 CDD:275368 7/19 (37%)
zf-H2C2_2 491..515 CDD:290200 7/23 (30%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.