DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB24 and CG9215

DIOPT Version :9

Sequence 1:NP_055612.2 Gene:ZBTB24 / 9841 HGNCID:21143 Length:697 Species:Homo sapiens
Sequence 2:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster


Alignment Length:410 Identity:101/410 - (24%)
Similarity:167/410 - (40%) Gaps:79/410 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   171 LQEEKSE---LAAEEEIQLRVNNSVQNRQNFVVKGDSGVLNEQIAAKEKEESEPTC-----EPSR 227
            ::|||::   |..:..:.|.:|: .|.:.:...:.:     |:...|:::|.|...     :|..
  Fly   169 VKEEKTDSLSLIPDGAMVLSLND-FQAQDSITQQAE-----EKDPKKQQDEDEGQAKMLELDPWD 227

Human   228 EEEMPVEKDENYDPKTEDGQASQ----------SRYSKRRIWRSV--KLKDYKLVGDQEDHGSAK 280
            :|..|....|...|..|:...:.          :...|:|.:|.|  .:|..||..:.:|...| 
  Fly   228 DENTPEHLYEIETPLIEESVVASPPLPLPPTHPANQQKKRTYRRVSPNVKHEKLTANVDDDFKA- 291

Human   281 RICGRRKRPGGPEARCKDCGKVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQVHTRMHT 345
                      |...:.::|             :||     |..|:.||..:..:|:|..|.|.|.
  Fly   292 ----------GSTTKRRNC-------------ERS-----PKICDVCGNTYKYQHALNAHMRRHN 328

Human   346 GERPYTCTVCSKALTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHYRVHTGHSLPECKD 410
            .||||:|.||.||..:...|..||.:|:|||.::|..|.:.||.....|.|.|:|||.....|:.
  Fly   329 NERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEV 393

Human   411 CHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGKSFSDSS 475
            |::.|.....|..|.|||||:|.|.|..|.|.||.|:.|..|:..|||.......:...| :|:|
  Fly   394 CNKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRGSGNGEASVASSS-ADAS 457

Human   476 AKRRHCIL--HTGKKPFSCP-----------------EC----NLQFARLDNLKAHLKIHSKEKH 517
            ::.::...  .:.:|....|                 ||    :..|...||.:.........:|
  Fly   458 SRNQNASARKESARKQQQIPESFSLDSVELEQTKVLEECIVANDFMFNEEDNAEQEANDREGLQH 522

Human   518 ASDASSISGSSNTEEVRNIL 537
            ......:.|..:.:.|:.::
  Fly   523 DDSYPYVGGYQSVDSVKELV 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB24NP_055612.2 BTB 27..133 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..176 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..254 10/59 (17%)
C2H2 Zn finger 296..316 CDD:275368 2/19 (11%)
COG5048 <321..480 CDD:227381 61/158 (39%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 8/19 (42%)
C2H2 Zn finger 380..400 CDD:275368 7/19 (37%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
C2H2 Zn finger 464..480 CDD:275368 3/15 (20%)
C2H2 Zn finger 492..512 CDD:275368 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..697
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 20/109 (18%)
COG5048 <303..439 CDD:227381 56/140 (40%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
zf-H2C2_2 319..344 CDD:290200 13/24 (54%)
zf-C2H2 333..355 CDD:278523 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
zf-H2C2_2 347..371 CDD:290200 9/23 (39%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-H2C2_2 375..400 CDD:290200 9/24 (38%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 404..427 CDD:290200 12/22 (55%)
C2H2 Zn finger 419..439 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.