DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB24 and CG32121

DIOPT Version :9

Sequence 1:NP_055612.2 Gene:ZBTB24 / 9841 HGNCID:21143 Length:697 Species:Homo sapiens
Sequence 2:NP_001097599.1 Gene:CG32121 / 317867 FlyBaseID:FBgn0052121 Length:648 Species:Drosophila melanogaster


Alignment Length:706 Identity:126/706 - (17%)
Similarity:231/706 - (32%) Gaps:210/706 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    11 QLVVHSDA----------HSDTVLASFEDQRKKGFLCDITLIVENVHFRAHKALLAASSEYFSMM 65
            |.:.|:|:          |..::|::......:..|.|:|:..|....|||:.:|:|.|.:|..:
  Fly    19 QQLQHNDSQQQFCLRWHNHQTSLLSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSACSSFFMDI 83

Human    66 FAEEGEIGQSIYMLEGMVADTFGILLEFIYTGYLHASEKSTEQILATAQFLKVYDLVKAYTDFQN 130
            |.........:.::.|........||.|:|:|.::..|:....:|..|:.|.    :|...|.||
  Fly    84 FRALEASNHPVIIIPGASFGAIVSLLTFMYSGEVNVYEEQIPMLLNLAETLG----IKGLADVQN 144

Human   131 NH----------------------------SSPKPT-TLNTAGAP-----------------VVV 149
            |:                            .||.|| ||..:..|                 ..:
  Fly   145 NNLPKTARSGGGSYMDTTNEKSSEFERPTTPSPTPTPTLTPSHTPTPSHSLPLPQLPSAALNTPL 209

Human   150 ISNKKNDPPKRKRGR-----------------PKKVN---TLQEEKSELAAEEEIQLRVNNSVQN 194
            ::||.........|.                 |:.:|   |...:.:||.|:.:.|.::.     
  Fly   210 LANKLGSVNSSGMGTTPLENLFKSLQFYPSLLPQPLNFSQTALNKTTELLAKYQQQCQLY----- 269

Human   195 RQNFVVKGDSGVLNEQI------AAKEKEESEPTCEPSREEEMPVEKDENYDPKTEDGQASQSRY 253
                    .||:..:|:      :.:.|.:|.|      :|...:||....:||:.....|.|..
  Fly   270 --------QSGMQEDQLETDCFGSKRLKGDSPP------KELRRLEKSLLKNPKSSSTTNSSSSK 320

Human   254 SKRRIWRS---VKLKDYKLVGDQEDHGSAKRICGRRKRPGGPEARCKDC--------GKVFK--- 304
            |.:.....   |......|......|.|          |..|..:|...        |:::.   
  Fly   321 SPQECSNPNPIVATSPVTLAPPTMAHFS----------PQLPVVKCSSASYPSALGQGQLYSSKP 375

Human   305 --YNHFLA---------IHQRSHTGERPFKCNECGKGFAQKHS-LQVHTRMHTGERPYTCTVCSK 357
              |:..:.         :|.....|..|:..       |:.|: ||:|...:..|........:.
  Fly   376 PLYSAAVTPTAAQQAAQMHHHPQPGPSPYIS-------AEDHAKLQLHIEQYQREAAAAAAAAAG 433

Human   358 ALTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQNRQLKSHYRVHTGHSLPECKDCHRKFMDVSQLK 422
            .:....:..|...|     |.:.|:.....:...:..|:.:::.     .|..||::..:...|:
  Fly   434 GMALVSAKSEPNLL-----SLSADRDKSLATAPIKPPSNSKLYA-----TCFICHKQLSNQYNLR 488

Human   423 KHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCGICGKSFSDSSAKRRHCILHTGK 487
            .||.||...: :.|.:|.....:|.:|:.|:.......|..|       .:.:.::|...|....
  Fly   489 VHLETHQNVR-YACNVCSHVSRSKDALRKHVSYRHPGAPSPC-------ENEARRKRVSKLAATT 545

Human   488 KPFSCPECNLQFARLDNLKAHLKIHSKEKHASDASSISGSSNTEEVRNILQLQPYQLSTSGEQEI 552
            .|.|.|.         ::.|...:.|.:...:.|:::..|.  :|.||     ||.         
  Fly   546 VPTSTPM---------SMSASHTVTSGDVGPAPATTLGCSG--QEARN-----PYL--------- 585

Human   553 QLLVTDSVHNINFMPGPSQ----GISIVTAESSQNMTADQAANLTLLTQQPEQLQN 604
                        |:|...|    ..::..||||   .|....:|.|..:.|..:::
  Fly   586 ------------FLPNQFQMAAAAAAVAVAESS---PASGQPSLDLAHEAPPSIKS 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB24NP_055612.2 BTB 27..133 CDD:306997 27/133 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..176 14/110 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..254 11/50 (22%)
C2H2 Zn finger 296..316 CDD:275368 4/41 (10%)
COG5048 <321..480 CDD:227381 27/159 (17%)
C2H2 Zn finger 324..344 CDD:275368 5/20 (25%)
C2H2 Zn finger 352..372 CDD:275368 1/19 (5%)
C2H2 Zn finger 380..400 CDD:275368 2/19 (11%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 5/19 (26%)
C2H2 Zn finger 464..480 CDD:275368 1/15 (7%)
C2H2 Zn finger 492..512 CDD:275368 2/19 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..697
CG32121NP_001097599.1 BTB 48..142 CDD:279045 23/97 (24%)
BTB 56..149 CDD:197585 26/96 (27%)
C2H2 Zn finger 474..494 CDD:275370 6/19 (32%)
C2H2 Zn finger 501..518 CDD:275370 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.