DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB24 and ztf-16

DIOPT Version :9

Sequence 1:NP_055612.2 Gene:ZBTB24 / 9841 HGNCID:21143 Length:697 Species:Homo sapiens
Sequence 2:NP_001024851.1 Gene:ztf-16 / 180756 WormBaseID:WBGene00019960 Length:480 Species:Caenorhabditis elegans


Alignment Length:453 Identity:101/453 - (22%)
Similarity:166/453 - (36%) Gaps:122/453 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   324 CNECG---------KGFAQKHSLQVHTRMHTGERPYTCTV-----CSKALTTKHSLL-------- 366
            |.|||         :|..:||..: |:|..:||...:.|:     ...:..:..|..        
 Worm     7 CTECGFTTTVFSEFQGHIEKHENE-HSRSSSGEMSNSQTIEWGDGIQSSTPSPRSTPPSDPTPSP 70

Human   367 ---EHMSLH-----------------SGQKS-FTCDQCGKYFSQNRQLKSHYRVHTGH--SLPEC 408
               ||:..|                 .|||: ..|..|......::.:|||...|..|  .:.:|
 Worm    71 DSDEHLEHHISITEITNTLIKKEPGTKGQKTVHVCPHCNFTTCMSQHMKSHLEAHERHQGQMYQC 135

Human   409 KDCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQ----THIRIHRGEKPYSCGI--C 467
            ..|..:|...:.:.:|...|:|.||:.|..|.|.|..|..:|    |||:...|   :.|.:  |
 Worm   136 DICKMQFSQKANMHRHRMRHSGVKPYECRFCKKRFFRKDQMQEHSMTHIKTGFG---FDCPVSQC 197

Human   468 GKSFSDSSAKRRHC-ILHT--GKKPFSCPECNLQFARLDNLKAHLKIHSKEKHASDASSISGSSN 529
            ...||..:|.|.|. ..||  ...|.||..|||.||.    ...|.:|.:.:| .|:.|.....|
 Worm   198 NMQFSQHNALRAHLEETHTISSTNPASCKRCNLMFAN----SRRLLLHFQTRH-DDSESSPKKEN 257

Human   530 TEEVR-----NILQLQPYQLSTSGEQEIQLLVTDSVHNINFMPGPSQGISIVTAESSQNMTADQA 589
            |.:.:     |.|.:.|..:|.:  :::|.:|..     .|.| |:       .::|.|.|:.:.
 Worm   258 TPKRKKLSNGNALPMDPANMSIT--EQLQRMVKS-----EFSP-PN-------TDTSDNSTSSEF 307

Human   590 ANL--TLLTQQPEQLQNLILSAQQEQTEHIQSLNMIESQMGPSQTEPVHVITLSKETLEHLH--- 649
            ..:  :.....|:.|              :..||.:....|..:..|..::.:....|..||   
 Worm   308 DKIPPSFPMANPDIL--------------LMCLNQMNQFNGFGENIPRPMLNIPNIPLPALHNIP 358

Human   650 -----AHQEQ----TEELHLATSTSDPAQHLQLTQEPGPPPP-------THHVPQPTPLGQEQ 696
                 ..|:|    :|:...:.|.|.|:.    :::...||.       |.....|||..:::
 Worm   359 AVAAIVKQDQVQLWSEQTSSSVSVSAPSP----SEQSHSPPANESSLSLTEKEKSPTPEKEDE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB24NP_055612.2 BTB 27..133 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..254
C2H2 Zn finger 296..316 CDD:275368
COG5048 <321..480 CDD:227381 50/206 (24%)
C2H2 Zn finger 324..344 CDD:275368 9/28 (32%)
C2H2 Zn finger 352..372 CDD:275368 4/35 (11%)
C2H2 Zn finger 380..400 CDD:275368 5/19 (26%)
C2H2 Zn finger 408..428 CDD:275368 4/19 (21%)
C2H2 Zn finger 436..456 CDD:275368 9/23 (39%)
C2H2 Zn finger 464..480 CDD:275368 6/17 (35%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..697 12/56 (21%)
ztf-16NP_001024851.1 C2H2 Zn finger 105..125 CDD:275368 5/19 (26%)
C2H2 Zn finger 135..155 CDD:275368 4/19 (21%)
C2H2 Zn finger 163..183 CDD:275368 6/19 (32%)
C2H2 Zn finger 225..246 CDD:275368 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.