DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC6 and Pten

DIOPT Version :9

Sequence 1:NP_001243793.1 Gene:DNAJC6 / 9829 HGNCID:15469 Length:970 Species:Homo sapiens
Sequence 2:NP_001162933.1 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster


Alignment Length:363 Identity:92/363 - (25%)
Similarity:161/363 - (44%) Gaps:63/363 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   107 SRVIQSVTS------YTKG-DLDFTYVTSRIIVMSFPL-DNVDIGFRNQVDDIRSFLDSRHLDHY 163
            |.||::|.|      ..|| |||.||:...||.|.:|. |.::..|||:::|:...|:..|..||
  Fly     9 SNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHY 73

Human   164 TVYNL-SPKSYRTAKFHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAA 227
            .:||| |.:||..|||..||:...:.....|::..:...|.::..||.::..||..|||..|:..
  Fly    74 KIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGR 138

Human   228 SSILVGAMFIFCNLYSTPGPAIRLLYAK----RPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPL 288
            :..::.|..:|..:..:...|:.....|    |.|:.: ||.|||:.|...|:...      .|.
  Fly   139 TGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTI-PSQRRYVQYFSKLVCSS------VPY 196

Human   289 TIKSITVSPIPFFNKQ--RNGCRPYCDVLIGETKIYSTCTDF---ERMKEYRVQDGKIFIPLNIT 348
            :..|:.|..|.|....  :|.....|.:.:    ::.:.|:.   :|:|...:...|.|:   :|
  Fly   197 SKVSLNVCEIRFSESSCVQNLGMVECSISV----LHDSATENAKPDRLKTLPIDFQKSFV---LT 254

Human   349 VQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFI------PLDTTVLKF----TKPELDA 403
            ::..:.||     ..:...|..|..:..|.....:|.|:      ..|.||.|:    :|.|:| 
  Fly   255 IKPSIPVS-----GDVKFELTKKSPDKIICHFWLNTFFVRNYSPCESDGTVNKYIHTLSKSEID- 313

Human   404 CDV-----PEKYPQLFQVTL---------DVELQPHDK 427
             ||     .:::.:.|::::         ||:.:..:|
  Fly   314 -DVHKDSEHKRFSEEFKISIVFEAENFSNDVQAEASEK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC6NP_001243793.1 PTEN_C2 283..421 CDD:313607 31/166 (19%)
Atrophin-1 <562..829 CDD:331285
DnaJ <918..963 CDD:99751
PtenNP_001162933.1 PTPc 58..167 CDD:304379 29/108 (27%)
PTEN_C2 196..335 CDD:287393 29/152 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.