DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF144A and ari-1

DIOPT Version :9

Sequence 1:NP_001336110.1 Gene:RNF144A / 9781 HGNCID:20457 Length:318 Species:Homo sapiens
Sequence 2:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster


Alignment Length:212 Identity:63/212 - (29%)
Similarity:93/212 - (43%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    20 CKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVEL-LIKEGLETAISCPDAACPKQGHLQENEI-- 81
            |::|..:.|.:.|..: :|...||..|..:|:.. ::.|||...|||....|    .:..:::  
  Fly   133 CEICFSQLPPDSMAGL-ECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGC----DILVDDVTV 192

Human    82 -ECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCST 145
             ..:..|.:..:|::|.....|..:....|||:..|....:   |....|:.|.|| |...||..
  Fly   193 ANLVTDARVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVK---VPYAEPRRVHCK-CGHVFCFA 253

Human   146 CKASWHPGQGCPETMPITFLPGETSAAFKMEEDD--------APIKRCPKCKVYIERDEGCAQMM 202
            |..:||....|      .:|    ....|..:||        |..|.||:|.|.||:|.||..|:
  Fly   254 CGENWHDPVKC------RWL----KKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMV 308

Human   203 CK--NCKHAFCWYCLES 217
            ||  |||:.|||.||.|
  Fly   309 CKNQNCKNEFCWVCLGS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF144ANP_001336110.1 mRING-HC-C4C4_RBR_RNF144A 19..72 CDD:319691 16/52 (31%)
modified RING-HC finger (C4C4-type) 20..70 CDD:319691 15/50 (30%)
IBR 91..156 CDD:214763 18/64 (28%)
IBR <177..216 CDD:307574 23/48 (48%)
ari-1NP_001245736.1 IBR 204..264 CDD:214763 18/63 (29%)
IBR <286..326 CDD:279784 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.