Sequence 1: | NP_001336110.1 | Gene: | RNF144A / 9781 | HGNCID: | 20457 | Length: | 318 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245736.1 | Gene: | ari-1 / 32796 | FlyBaseID: | FBgn0017418 | Length: | 503 | Species: | Drosophila melanogaster |
Alignment Length: | 212 | Identity: | 63/212 - (29%) |
---|---|---|---|
Similarity: | 93/212 - (43%) | Gaps: | 33/212 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 20 CKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVEL-LIKEGLETAISCPDAACPKQGHLQENEI-- 81
Human 82 -ECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCST 145
Human 146 CKASWHPGQGCPETMPITFLPGETSAAFKMEEDD--------APIKRCPKCKVYIERDEGCAQMM 202
Human 203 CK--NCKHAFCWYCLES 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RNF144A | NP_001336110.1 | mRING-HC-C4C4_RBR_RNF144A | 19..72 | CDD:319691 | 16/52 (31%) |
modified RING-HC finger (C4C4-type) | 20..70 | CDD:319691 | 15/50 (30%) | ||
IBR | 91..156 | CDD:214763 | 18/64 (28%) | ||
IBR | <177..216 | CDD:307574 | 23/48 (48%) | ||
ari-1 | NP_001245736.1 | IBR | 204..264 | CDD:214763 | 18/63 (29%) |
IBR | <286..326 | CDD:279784 | 23/40 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |