DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD151 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_001034579.1 Gene:CD151 / 977 HGNCID:1630 Length:253 Species:Homo sapiens
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:246 Identity:74/246 - (30%)
Similarity:120/246 - (48%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    16 LKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCC 80
            :||.||.:|..|.:.|:.::|||....|:.:.| .|..:|.:.:....|:|.|:.:::....||.
  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGY-KLFLAGKFFSIPTFLIVIGSFIIIISFFGCW 74

Human    81 ATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMT---KRYHQPGHEAV 142
            ...||...|:..:.::|.|||:||:.|||..|.    |..:..:.:|.::|   ..|:.....|.
  Fly    75 GALKENYCLVLSFSVMLAIIFILELAAGISGYV----LRNDASDLIKTSLTYSLNEYNSINPNAT 135

Human   143 TSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCG------QRDHASNI 201
            |...|.:|.||.|||..:..|     ||.:...|.  :|.|||...|...|      .:...::.
  Fly   136 TKLWDDIQDEFECCGVTSYND-----WITAFPNGD--LPISCCNVHVGAVGTFTCNNAQSSVADR 193

Human   202 YKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEH 252
            :||  ||:.....:|..|...:||.|:.||.:|.||:||.|.:.|.:|:.:
  Fly   194 HKV--GCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAREIKIRN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD151NP_001034579.1 Tetraspannin 16..244 CDD:395265 72/236 (31%)
CD151_like_LEL 112..220 CDD:239408 29/116 (25%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 73/240 (30%)
tetraspanin_LEL 106..210 CDD:239401 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.