DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and HDAC1

DIOPT Version :10

Sequence 1:XP_011510519.1 Gene:HDAC4 / 9759 HGNCID:14063 Length:1113 Species:Homo sapiens
Sequence 2:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster


Alignment Length:75 Identity:19/75 - (25%)
Similarity:30/75 - (40%) Gaps:19/75 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    77 GQERFRSLTTAF-FRDAMG-FLLMFDLTSQQS-------FLN-------VRNWMSQLQANAYCEN 125
            ||..|:.:|:.: ...::| :..|.||.|:..       |:|       ...|.:.|.|   |.|
  Fly   465 GQRYFKLMTSEYGIVPSIGHYSCMIDLFSRSGRLEEAMRFINGMPFPPDAIGWTTLLSA---CRN 526

Human   126 PDIVLIGNKA 135
            ...:.||..|
  Fly   527 KGNLEIGKWA 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4XP_011510519.1 ClassIIa_HDAC4_Gln-rich-N <115..176 CDD:197398 7/21 (33%)
HDAC4 678..1086 CDD:212530
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:450134
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.