DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD81 and Tsp42Er

DIOPT Version :9

Sequence 1:NP_004347.1 Gene:CD81 / 975 HGNCID:1701 Length:236 Species:Homo sapiens
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:105/236 - (44%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    10 IKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAP-NTFYVGIYILIAVGAVMM 73
            |:||.|:|||:.     .:||:|..:      .|::.:   |:.|| :...:|:|  ||||:::.
  Fly     8 IRYLAFLFNFLC-----AVLGIATIV------VNVIAI---DQIAPKDQLILGLY--IAVGSIVF 56

Human    74 FVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFV-----NKDQIAKDVKQFYDQALQQ 133
            .:.|.||:|||:||.|:...:.|.::::....:   :..||     .:|.|.| :||.:  |.|.
  Fly    57 LLSFFGCFGAIKESICVTWAYATSMLVMLIVSI---VMLFVFRMHFEEDSITK-LKQAF--AKQT 115

Human   134 AVVDDDANNAKAVVKTFHETLDCCG-------SSTLTALTTSVLKNNLCPSGSNIISNLFKEDCH 191
            ...|     |.|..:|.::   |||       ......:.:|....|..|         :::.|.
  Fly   116 NTFD-----AMAEYQTQYQ---CCGIYKLKDYGDAYITVPSSCYDQNDTP---------YRDGCL 163

Human   192 QKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRN 232
            .|::..:...|....|...::.||.|.....|.::...:||
  Fly   164 AKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGVSLRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD81NP_004347.1 Tetraspannin 10..226 CDD:395265 57/228 (25%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 56/225 (25%)
tetraspanin_LEL 93..174 CDD:239401 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.