DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SART3 and RnpS1

DIOPT Version :9

Sequence 1:XP_005269298.1 Gene:SART3 / 9733 HGNCID:16860 Length:981 Species:Homo sapiens
Sequence 2:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster


Alignment Length:367 Identity:69/367 - (18%)
Similarity:115/367 - (31%) Gaps:135/367 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   606 AALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIP 670
            ||...::::|...|.|:|:..::.::..|...|..:...|.:...  |.......:.||..::..
  Fly   103 AAGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERDR--DRRSRSRDRARRAGSNDR 165

Human   671 AAGETQNVEVAAGPAGKCA---------AVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFV 726
            ||.::.||:.....:...:         :|:..||.|::|::.|..|       ..|...:.:.|
  Fly   166 AAADSNNVKRERSRSASRSRSPRRRGRGSVERTPPPKRRERSRSRTR-------SPSPKQVRIHV 223

Human   727 SNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGR 791
            ..|..::.:..     :||          |||:.||.                            
  Fly   224 GRLTRNVTKDH-----VFE----------IFSSFGDV---------------------------- 245

Human   792 PMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAG 856
                       ||.:|.|.|:      |..|                                  
  Fly   246 -----------KNVEFPVDRF------HPNF---------------------------------- 259

Human   857 KPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTY 921
             .:|:|:|||........|:..|||..|....|.|:    |...|.::|..|: |..||..||..
  Fly   260 -GRGVAFVEYATPEDCESAMKHMDGGQIDGQEITVS----PVVLVKQRPPMRR-PSPPMRRPQNN 318

Human   922 -----------------GARGKGRTQLSLLPRALQRPSAAAP 946
                             |..|.||.|..:..|...|..:.:|
  Fly   319 RWRSPPQFNRFNNRGGGGGGGGGRRQSPMRNRRSPRRRSRSP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SART3XP_005269298.1 RNA14 100..>478 CDD:227438
NRDE-2 351..>504 CDD:285605
RRM 654..876 CDD:223796 35/230 (15%)
RRM1_SART3 723..796 CDD:240837 9/72 (13%)
RRM2_SART3 817..897 CDD:240838 14/79 (18%)
LSM_int_assoc 895..951 CDD:293211 17/69 (25%)
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 37/210 (18%)
RRM_RNPS1 221..294 CDD:240811 27/167 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15481
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.