DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB11FIP3 and nuf

DIOPT Version :9

Sequence 1:NP_001357330.1 Gene:RAB11FIP3 / 9727 HGNCID:17224 Length:801 Species:Homo sapiens
Sequence 2:NP_001246751.1 Gene:nuf / 39572 FlyBaseID:FBgn0013718 Length:541 Species:Drosophila melanogaster


Alignment Length:414 Identity:110/414 - (26%)
Similarity:192/414 - (46%) Gaps:97/414 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   447 HKQINRLEDLSARLSDLEMNSPTKRLSSKKVARYLHQ---------------------------S 484
            :.:|..||:|:::.::...|:.|.....:.:..:.::                           :
  Fly   161 NNKIYNLENLTSKFNNKTNNTNTNGFKLENLKNFKNKLLCDFEDTNSGGGGGGGSGGSGPVGMMN 225

Human   485 GALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANAL 549
            |||:.|..            :::.:::..|:|:|.:|........::.:|.:.|...|..|.:.|
  Fly   226 GALSAEIC------------DNLNEQLELLQRKVDDLSDTQNIAEDRTTRTKTEYAVLQARYHML 278

Human   550 EEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKA-- 612
            |||.:|.||||.|.:.||.:|.:|:|.::|||.|::.||.|.:::..:.|.:.||.....|:.  
  Fly   279 EEQYRESELRAEERLAEEQKRHREILARVEREASLQNENCQMKIRATEIEATALREEAARLRVLC 343

Human   613 -----NIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRK 672
                 ::.|.||:.:...|:|..|.....|:.:..||      ||     ::|::|:||      
  Fly   344 DKQANDLHRTEEQLELARDQIGVLQQEHEEQAQALRR------HE-----QEKKSTEEL------ 391

Human   673 QLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARES----ELEQEVRRLKQDNRNLKEQNEELNGQI 733
                  :|:|..|.:|.|..| |.:...:.:.||    ||.||:..::|.||.|:||||||...:
  Fly   392 ------MLELGRELQRAREES-GARAMPTTSPESIRLEELHQELEEMRQKNRTLEEQNEELQATM 449

Human   734 ITLSI--------QGAKSLFSTAFSESLAAEISSVSR-------------DELMEAIQKQEEINF 777
            :|...        ||...|..|.  .|||.|:..:|:             .:|.:|.|::|:.|.
  Fly   450 LTNQATMLTNGVEQGRHLLNGTL--NSLAQELEEMSQAQDSVDSATLASLSQLQQAFQEKEDENV 512

Human   778 RLQDYIDRIIVAIMETNPSILEVK 801
            ||:.|||.|::.|:|..|.:||||
  Fly   513 RLKHYIDTILLNIVENYPQLLEVK 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB11FIP3NP_001357330.1 PRK07764 <3..223 CDD:236090
EF-hand_7 206..264 CDD:338778
SMC_prok_B <515..787 CDD:274008 91/303 (30%)
RBD-FIP 761..801 CDD:312830 17/52 (33%)
nufNP_001246751.1 VirB5_like 436..>506 CDD:295212 20/71 (28%)
RBD-FIP 496..536 CDD:255374 16/39 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146933
Domainoid 1 1.000 101 1.000 Domainoid score I6943
eggNOG 1 0.900 - - E1_KOG0982
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4691
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1419449at2759
OrthoFinder 1 1.000 - - FOG0002087
OrthoInspector 1 1.000 - - otm41452
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15726
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4084
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.