DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEMA3E and Sema1b

DIOPT Version :9

Sequence 1:NP_036563.1 Gene:SEMA3E / 9723 HGNCID:10727 Length:775 Species:Homo sapiens
Sequence 2:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster


Alignment Length:621 Identity:186/621 - (29%)
Similarity:295/621 - (47%) Gaps:86/621 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    62 LLDEYQERLFVGGRDLVYSLSLERISDGYKEI---HWPSTALKMEECIMKGKDAGECANYVRVLH 123
            :||...|.:.||.:|::|::||    :|.|||   .|.||....|.|.:|||...:|.||:||..
  Fly    63 ILDHNDEFVLVGAKDVIYNVSL----NGLKEIARLEWHSTDADRELCALKGKHEWDCHNYLRVYA 123

Human   124 HYNRTHLLTCGTGAFDPVCAF---IRVGYHLEDPLFHLESPRSERGR-----GRCPFDPSSSFIS 180
            ......:|.|||.::.|.|..   :.|.........|..:.|.|..|     |.||:.|:.:...
  Fly   124 LRPNGEVLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYSPAHNSTY 188

Human   181 TLIGSELFAGLYSDYWSRDAAIFRSMGRLAHIRTEHDDERLLKEPKFVGSYMIPDNEDRDDNKVY 245
            ......|::...:|:...|..|:|.     ::|||..|.:.|.:|.|||:.       ..:..|.
  Fly   189 AFADGHLYSATVADFSGGDPLIYRE-----NLRTEQYDLKQLNQPDFVGAI-------ERNGYVL 241

Human   246 FFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRILVNKWSTFLKARLVCSVPGMNGIDTYFDELE 310
            |||.|.::|..|...|:|:||.|:|.||.||.......|::||||||.|||||  ....||||::
  Fly   242 FFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPG--EFPFYFDEIQ 304

Human   311 DVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHKEGPEYHW-SVYEGKV 374
            .:..:.....|: :|:.:|.|:.|...|.|:|.:::..|.|||:|.:..::..:.|| .|...:|
  Fly   305 AISPIVESGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQV 368

Human   375 PYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHKKPILVKTDGKYNLKQIAV- 438
            |.||||.|..        .::.....|:.|.::||||.:|:...|.:|:|.|.:..:.|..||| 
  Fly   369 PKPRPGQCVE--------DSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVH 425

Human   439 DRVEAEDG-QYDVLFIGTDNGIVLKVITIY----NQEMESMEEVILEELQIFKDPVPIISMEISS 498
            .:|::..| .|||::.|||:|.|.|.|.|.    |..::.::.|::.|:|:.....||..:.||:
  Fly   426 PQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIRELVIST 490

Human   499 KRQQLYIGSASAVAQVRFHHCDMYGSACADC--CLA-RDPYCAWDGISCSRYYPTGTHAKRRFRR 560
            .:..|.:.|..::..|..|||    |...||  ||: :||.||||         ..||       
  Fly   491 SKNSLVVVSDGSLVSVPLHHC----SHIVDCLGCLSLQDPICAWD---------LQTH------- 535

Human   561 QDVRHGNAAQQCFGQQFVGDALDKTEE-------HL---AYGIENNSTLLECTPRSLQAKVIWF- 614
             :.::...:|..||.:....:|:.|::       |:   |.|.|..|.:....|.:.:.|:::. 
  Fly   536 -EC
KNLATSQHKFGTKTYLQSLNSTKKAAALLCPHIPRDAPGAETVSFVTMAPPPTEEQKLLYSN 599

Human   615 --VQKGRETRKEEVKTDDRVVKMDLGLLFLRLHKSD 648
              ..:|.:...|:..|...    |.||..:.|...|
  Fly   600 VGSSQGNQPSLEQQPTGGD----DFGLNKITLTSMD 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEMA3ENP_036563.1 Sema_3E 49..519 CDD:200514 151/474 (32%)
PSI 518..566 CDD:214655 15/50 (30%)
Ig_Semaphorin_classIII 585..670 CDD:143279 16/77 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 742..775
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 151/474 (32%)
PSI 510..>537 CDD:214655 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.