DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L5 and CG2663

DIOPT Version :9

Sequence 1:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:295 Identity:53/295 - (17%)
Similarity:109/295 - (36%) Gaps:60/295 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   249 LRHWLQ-ETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLSWR------------KQHQVDLL 300
            :|.||: :.|..|...|..:..|||...|.|:|.::.|....:.|            .:.:::::
  Fly    34 IREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSNRDINREELNIV 98

Human   301 LQTWQPPAL--------LEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSV 357
            |.....|.|        ...|..|    .|.|.:|.:||     |...:...:|:..|...  ||
  Fly    99 LDYVHCPTLPGITPNGRRITFIRG----IDCDFQPHHIL-----DAMKVALMIGDVRLAEE--SV 152

Human   358 NEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIV 422
            ...|.                 ..:||....:..|..:.....:.:.:..|::.||..:..:.::
  Fly   153 GIAGD-----------------IFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEVHVI 200

Human   423 RAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGL 487
            ....:...::..:.||:.|..|.:...::...     .|...:.|:::|:..||::      ||:
  Fly   201 NISPLVDTIFNFVKPFVKEKIRSRITFHNDVE-----SLYKVVPRDLLPNEYGGKA------GGV 254

Human   488 VPKSLYMTEEEQEHTDQLWQWSETYHSASVLRGAP 522
            |..:.:..::..::|.......:...:.|:..|||
  Fly   255 VELNQWWKQKLVDNTQWFKDQEDKKANESLRPGAP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 13/39 (33%)
SEC14 306..479 CDD:214706 30/180 (17%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 13/39 (33%)
SEC14 95..250 CDD:238099 30/187 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.