DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L5 and CG33965

DIOPT Version :9

Sequence 1:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:54/305 - (17%)
Similarity:112/305 - (36%) Gaps:80/305 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   203 LEAHGPRS--TLGPALEAVSMDGDKLDADYIERCLGHLTPMQESCLIQLRHWLQ-ETHKGKIPKD 264
            :....|.|  .|.|.|:.|:::.           |..:....||.:..|:.||| :.|.....:|
  Fly     1 MSGSSPNSIRPLPPGLQKVAIEE-----------LNEVPSRVESDIAALKEWLQKQPHLCACLED 54

Human   265 EHILRFLRAHDFHLDKAREMLRQSLS--------WRKQHQVD--LLLQTWQPPALL-----EE-- 312
            :.:|.|||...|.|:||::.:.:..|        :..|..||  .:|:..:...:|     ||  
  Fly    55 QFLLSFLRGSKFSLEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDT 119

Human   313 ------FYAGGW-----HYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEEGQKRCE 366
                  ..||.:     .:||       |:|:|.|        .||      ::.:.::...   
  Fly   120 GPAVTIIRAGSYDINKFKFQD-------IIRVGSM--------FGE------IMMLEDDNAS--- 160

Human   367 GSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVL 431
                     :|.:..::|:.|:...:|:....:.|.:.....::..|.....:..:..|:.|...
  Fly   161 ---------VSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETG 216

Human   432 WTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGG 476
            :..:..:.....:.:..:.|     .|..:.:.:.:..:|:..||
  Fly   217 FKSLLGWFPGKIKERVSVSS-----DPEAIFERVPKHYLPEEYGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 3/12 (25%)
CRAL_TRIO_N 243..288 CDD:215024 16/45 (36%)
SEC14 306..479 CDD:214706 26/189 (14%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 16/44 (36%)
SEC14 101..256 CDD:238099 25/192 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.