DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L5 and CG33523

DIOPT Version :9

Sequence 1:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:502 Identity:98/502 - (19%)
Similarity:162/502 - (32%) Gaps:171/502 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   182 TPAPVRE-EDARNQAGPRDPSSLEAHGPRSTLGPALEAVSMDGDKLDADYIERCLGHLTPMQESC 245
            ||..:.| .|..|:.....|             ||......|.|::..|::              
  Fly     9 TPQQIEELRDRFNRKYASSP-------------PAAPFHPTDIDRIRNDHL-------------- 46

Human   246 LIQLRHWLQETHKGKIPKDEHILRFLRAHDFHLDKARE------MLRQSLSWRKQHQVDLLLQTW 304
                  |||              |||..:|..::.:..      :||||..   .:.:|      
  Fly    47 ------WLQ--------------RFLEMYDLDMETSFNSLWETCILRQSTG---ANDID------ 82

Human   305 QPPALLEEFYAGG---WHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEEGQKRCE 366
             ...|.:|:...|   .|..|:||:||.:.|:     |...|:...:.|:|.|:...|..|:.  
  Fly    83 -ESELNQEYLKEGSVFVHNTDVDGKPLLVFRV-----KMHSKSKNLDELIRIVVYWVERTQRE-- 139

Human   367 GSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLI---------- 421
                   :.::..|...|:.|.::..:....||   |::|..:..||.:|..:|:          
  Fly   140 -------QHLTQLTIFFDMSGTSLASMDLEFVK---RIVETFKQFYPNSLNYILVYELGWVLNAA 194

Human   422 ------VRAPRVFPVLWTLISPFINE--NTRRKFLIYSG-SNYQ-----------------GPGG 460
                  |..|:...:|..:....||:  |......|:.| .||:                 ..|.
  Fly   195 FKVIKAVLPPKAVEILKMISKKDINQYINKDNCLAIWGGEDNYEFSFVPEAKKVISKPVAANAGD 259

Human   461 LVDYLDREVIPDFLGGESVCNVPEGGLVPKSLYMTEEEQEHTDQLWQWSETYHSASVLRGAPHE- 524
            ...:.|::|  .|:..           .|..|..|...:.||.          |..:|...|.: 
  Fly   260 DDQFADKKV--TFVDS-----------APMVLKETNINKMHTP----------SEGMLHINPKDF 301

Human   525 VAVEILEGESVITWDFDILRGDVVFSLYHT-----KQAPRLGAREPGTRASGQLIDKGWVL---- 580
            |.......|:.:|.. .|....|.:.:..|     :..||.|..:|...|:..:    |:.    
  Fly   302 VNFNSKNAEATMTIK-SIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINI----WLKSEHK 361

Human   581 ----GRDYSRVEAPLVCREGESIQGSHVTRWPGVYLLQWQMHSPPSS 623
                .:|...|.| :|...|| ..|:.||.       .|:..||.|:
  Fly   362 LSDDSKDKFLVMA-MVAPGGE-CGGADVTE-------LWRSKSPTSA 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 6/32 (19%)
CRAL_TRIO_N 243..288 CDD:215024 9/50 (18%)
SEC14 306..479 CDD:214706 42/211 (20%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 33/156 (21%)
Motile_Sperm 293..396 CDD:279029 24/116 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.