DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L5 and Cralbp

DIOPT Version :9

Sequence 1:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:351 Identity:74/351 - (21%)
Similarity:128/351 - (36%) Gaps:93/351 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   232 ERCLGHLTPMQESCLIQLRHWL--QETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLSWRK- 293
            :||      .:|..|.|||:|:  .|..:.....|..:||||||..|.:..|.:.|.:.|:.|: 
  Fly    26 DRC------TREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRT 84

Human   294 ----QHQVDLLLQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHV 354
                ..|:|.|     .|.|.:....|            ||..:.|.|..|           |.|
  Fly    85 FPHMSTQLDYL-----EPRLGDLIDQG------------YIFAVPQRDKHG-----------RRV 121

Human   355 LSVNEEG-QKRCEGSTRQLGRPISSWTCLL--------------DLEGLNMRHL--WRPGVKALL 402
            :.:|.:| ..:...|..|......::.||:              |..|:...|:  |.|  ....
  Fly   122 VVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNP--TEFA 184

Human   403 RMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDR 467
            |:.:..|.:.|.....:.::..|.....|...:...::...:.:.:|| ||..:    |:..:|:
  Fly   185 RIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIY-GSEKE----LMKSVDQ 244

Human   468 EVIPDFLGGESVCNVPEGGLVPKSLYMTEEEQE----------------HTDQLWQWSETYHSAS 516
            ..:|          :..||.||....:...:||                .:|:..|...::::..
  Fly   245 GCLP----------LEMGGKVPMREMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGK 299

Human   517 VLRGAPHEVA-VEILEGESVITWDFD 541
            ...|.|:.|: :|.:|| |....:||
  Fly   300 ASTGGPNFVSQIESIEG-SFRKLEFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 17/46 (37%)
SEC14 306..479 CDD:214706 33/189 (17%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 17/46 (37%)
SEC14 101..254 CDD:238099 32/192 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.