DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L5 and CG12926

DIOPT Version :9

Sequence 1:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:354 Identity:77/354 - (21%)
Similarity:134/354 - (37%) Gaps:94/354 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   211 TLGPALEAVSMD-----GDKLDADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKD-EHILR 269
            :|.|.|...:.|     .|::|.| ||               .||.|:.:....|..:| :.::.
  Fly    11 SLSPELAKKAHDELGEIPDRIDED-IE---------------TLRTWISKQPHLKARQDAQFLVA 59

Human   270 FLRAHDFHLDKAR--------------EMLRQSLSWRKQHQV---DLLLQTWQPPALLEEFYAGG 317
            |||...:.|:|.:              |:.:..:...||..:   ..||:..||           
  Fly    60 FLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQP----------- 113

Human   318 WHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNE---EGQKRCEGSTRQLGRPISSW 379
               ...||..::|.|.||.|:|        :..:..|:.||.   |.|.|.:.:..     ||.:
  Fly   114 ---LQADGPRIHISRYGQYDSK--------KYSIAEVVQVNTMLGEIQIREDDNAM-----ISGF 162

Human   380 TCLLDLEGLNMRHLWRPGVKALLRMIEVVEDN-YPETLGRLLIVRAPRVFPVLWTLISPFINENT 443
            ..::|::|:...||::... .|::.:.|:.|. ||........|.||.......::....::|..
  Fly   163 VEIIDMKGVGAGHLFQFDA-VLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKI 226

Human   444 RRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGG-----ESVCNVPEGGLVPKSLYMTEEEQEHTD 503
            |::|.|:|..:     .|..|:.:|.:|...||     :.|.:.....|:....:..||....|:
  Fly   227 RKRFHIHSKLD-----SLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLLAYKPFFEEEASYGTN 286

Human   504 QLWQWSETYHSASVLRGAPHEVAVEILEG 532
            :           .:.||.|  |:.|.|.|
  Fly   287 E-----------KLRRGQP--VSAESLFG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 1/2 (50%)
CRAL_TRIO_N 243..288 CDD:215024 11/59 (19%)
SEC14 306..479 CDD:214706 40/181 (22%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 14/60 (23%)
SEC14 117..254 CDD:238099 37/155 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.