DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L5 and CG31826

DIOPT Version :9

Sequence 1:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:306 Identity:62/306 - (20%)
Similarity:114/306 - (37%) Gaps:83/306 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   231 IERCLGHLTPMQESCLIQLRHWLQ-ETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLSWRKQ 294
            :|:|.......:::.|.:..|:.: :|.|.          :...||::     |..|:..:|..:
  Fly    25 VEKCEDLRVGTEDTLLTKFLHYTRWDTIKA----------YQAIHDYY-----EFKRRHPTWVAR 74

Human   295 HQVDLLLQTWQPPALLEEFYAGGWH-----------------YQDIDG---RPLYILRLGQMDTK 339
            |.::...|.         ||  |.|                 ::.:||   .|.|:..|.:||  
  Fly    75 HPIEHYRQL---------FY--GTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMD-- 126

Human   340 GLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRM 404
               ..:.|..||  :..|.:.|                 .|.:.||:|.| |:..|....|.:::
  Fly   127 ---DLIFESLLL--LPRVQQNG-----------------ITVICDLQGTN-RNFLRQFSPAFMKV 168

Human   405 IEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREV 469
            :.......|.:...:.|::...:..|..||..||:|:..:.|...:.|.:......:|.|   |.
  Fly   169 VNEKNGVLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGY---ES 230

Human   470 IPDFLGGESVCNVPEGGLVPKSLYMTEEEQEHTDQLWQWSETYHSA 515
            :|...||.:. ||.:..|:...|   .:..|:.::|    :||..|
  Fly   231 LPAEYGGPAT-NVLDTNLIFNHL---SQNAEYLEKL----QTYGKA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 8/45 (18%)
SEC14 306..479 CDD:214706 40/192 (21%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 7/45 (16%)
CRAL_TRIO 92..237 CDD:279044 34/172 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.