DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD63 and Tsp74F

DIOPT Version :9

Sequence 1:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:238 Identity:61/238 - (25%)
Similarity:105/238 - (44%) Gaps:27/238 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     9 CVKFLLYVLLLA-----------FCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGV 62
            |.:|:.|.|.:|           ||.....|:......:| |...:..||.      .|::...:
  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNEL-LGTNLFSGAV------YVLLVTSI 67

Human    63 FLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYP 127
            .:.||:|:||.||.||..||::|:.|.::|:.:..:...:.|||||::|........|..|..|.
  Fly    68 IICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYG 132

Human   128 KNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVG----CGINFNEKAIHK 188
            .........|..|...:|||...:.||.:.     ..||:|||..:..|    |.|......::.
  Fly   133 SRREITQAWDLTQERLQCCGVDTWHDWNRY-----GPVPESCCQELFGGQRKECTIFPTITNLYN 192

Human   189 EGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSI 231
            :||:.....::|.:..|:...::.:|.:.:.|::|:|.|...|
  Fly   193 QGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 58/231 (25%)
CD63_LEL 105..203 CDD:239419 26/101 (26%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 57/228 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.