DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOCS5 and Socs16D

DIOPT Version :9

Sequence 1:NP_054730.1 Gene:SOCS5 / 9655 HGNCID:16852 Length:536 Species:Homo sapiens
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:316 Identity:81/316 - (25%)
Similarity:121/316 - (38%) Gaps:85/316 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   237 TAPVSP-------------HSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFE 288
            |||:.|             .:......:.:|::.|.:|                  |||.:....
  Fly   747 TAPLIPPIAVITSAPGAAGQTQLASELNGTLITAEADE------------------PNADLRKKF 793

Human   289 ATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSR 353
            .:..:.||    ||.|...|   ..:.||.....:.||..|...     |:.|.:...|.....:
  Fly   794 QSRALPPL----PKKALPFT---AAAYAIEAVKSEPEEVKTNAI-----QEPRALQFTSSIEKVK 846

Human   354 QGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVS 418
            ...|                        |||.:....||.:|..:|:|:|::|||:.:.|:||:|
  Fly   847 DYGW------------------------YWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLS 887

Human   419 FRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSC---MFF-------EPLLT 473
            |:..|...|.||||....|||.::  ..|.|.|:|..:|...:.|..   :||       .|:..
  Fly   888 FKLNNCVRHVRIEQDQGTFSFGSY--AKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRV 950

Human   474 ISLNRTFPF----SLQYICRAVICRCT-TYDGIDGLPLPSMLQDFLKEYH-YKQKV 523
            ...|....|    |||::||.||.:.. ..|.|..||||..|.|:|...| |.::|
  Fly   951 QLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQV 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOCS5NP_054730.1 Required for interaction with IL4R. /evidence=ECO:0000250 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..175
SOCS 146..195 CDD:403716
SH2 370..470 CDD:417686 34/109 (31%)
SOCS_SOCS5 479..534 CDD:239708 20/51 (39%)
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 34/123 (28%)
SOCS_SOCS7 960..1009 CDD:239710 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.