DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPM1F and Pp2C1

DIOPT Version :9

Sequence 1:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens
Sequence 2:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster


Alignment Length:348 Identity:89/348 - (25%)
Similarity:140/348 - (40%) Gaps:70/348 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   166 RRKMEDRHVSLPSFNQLFGLSDPVNR----AYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTD 226
            |:.|||:      |:..:..| |:..    |:|.::|||||.:||.:|..|:.....:|.:..:|
  Fly   267 RKYMEDQ------FSVAYQES-PITHELEYAFFGIYDGHGGPEAALFAKEHLMLEIVKQKQFWSD 324

Human   227 PE----GALRE-------AFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILV 280
            .:    .|:||       |..|..:.:.|.|......:|||...|.:....:::..:|||.::|.
  Fly   325 QDEDVLRAIREGYIATHFAMWREQEKWPRTANGHLSTAGTTATVAFMRREKIYIGHVGDSGIVLG 389

Human   281 QQGQVVK------LMEPHRPERQDEKARIEALGGFVS-----------------HMDCWRVNGT- 321
            .|.:..:      |...|:||...||.||:..||.|:                 |....|.... 
  Fly   390 YQNKGERNWRARPLTTDHKPESLAEKTRIQRSGGNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLV 454

Human   322 -----LAVSRAIGDV------FQKPYVSGEADAASRALTGSE-DYLLLACDGFFDVVPHQEVVGL 374
                 |||:|::||:      |::..||.:.|.....:..|. ..|:...||.::||..||.|..
  Fly   455 DEIPFLAVARSLGDLWSYNSRFKEFVVSPDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDS 519

Human   375 V-QSHLTRQ--------QGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDP 430
            | :.||..:        ..|...|.:.|...|.::...||.:|:.|.| .|.............|
  Fly   520 VRKEHLIGEILNEQDVMNPSKALVDQALKTWAAKKMRADNTSVVTVIL
-TPAARNNSPTTPTRSP 583

Human   431 QAEGRRQDLPSS--LPEPETQAP 451
            .|..|..||...  |.|.:.:.|
  Fly   584 SAMARDNDLEVELLLEEDDEELP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 76/299 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454 8/35 (23%)
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 79/306 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.