DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MORF4L2 and MRG15

DIOPT Version :9

Sequence 1:NP_001135890.1 Gene:MORF4L2 / 9643 HGNCID:16849 Length:288 Species:Homo sapiens
Sequence 2:NP_001262588.1 Gene:MRG15 / 41850 FlyBaseID:FBgn0027378 Length:429 Species:Drosophila melanogaster


Alignment Length:318 Identity:125/318 - (39%)
Similarity:176/318 - (55%) Gaps:47/318 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    13 QQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRK 77
            :|...|.....|::.: ..|:...:|:...:|||..|: |....|.....|..|  |.:.|..||
  Fly   115 EQMRNESRASTPSKDS-NTSQSTASSTPTTSAGPGSKS-EAGSTGTTTTNSTAN--STTSRAHRK 175

Human    78 NKQKTPGNGDGGSTS--------------EAPQPPRKKR-------------------------- 102
            :.|.||.....|:.|              |.|..|:|||                          
  Fly   176 STQSTPSTARPGTPSDKKEDPAAAETTEEEGPVAPKKKRMSEQRPSLTGSDVAEKPLPPTTTPST 240

Human   103 --ARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANC 165
              ....|.||||||:..::|||:|||:|||.:|.:||..|.|:.:|.:||||..|..|.|:|...
  Fly   241 PTTEPAPCVESEEAYAAKVEVKIKIPDELKHYLTDDWYAVVREHKLLELPAKVTVQQISEQYLAH 305

Human   166 KKS-QGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLL 229
            ||| :....:||.|:|:|:.||.||||||||:||||||||.|||:::..|||.|:|::||:.|||
  Fly   306 KKSVKSTSASKEVAINDVLDGIVEYFNVMLGSQLLYKFERTQYADVMQKHPDTPLSELYGSFHLL 370

Human   230 RLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKA 287
            |||||:|:||:|:.||::|:..||.::.||||:|.|||:..|:.|::.....||.|.|
  Fly   371 RLFVRLGSMLSYSALDQQSMQNLLTHVQDFLKFLVKNSSIFFSMSNFINVDPEYVRNA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MORF4L2NP_001135890.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 32/141 (23%)
MRG 110..276 CDD:399022 91/166 (55%)
MRG15NP_001262588.1 Tudor-knot 22..75 CDD:288553
MRG 249..415 CDD:283390 91/165 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149764
Domainoid 1 1.000 189 1.000 Domainoid score I3292
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I3130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 1 1.000 - - FOG0002343
OrthoInspector 1 1.000 - - otm41087
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10880
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R362
SonicParanoid 1 1.000 - - X1774
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.