DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IKBKE and STE11

DIOPT Version :9

Sequence 1:NP_054721.1 Gene:IKBKE / 9641 HGNCID:14552 Length:716 Species:Homo sapiens
Sequence 2:NP_013466.1 Gene:STE11 / 851076 SGDID:S000004354 Length:717 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:77/304 - (25%)
Similarity:129/304 - (42%) Gaps:70/304 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     9 WHTDDLLGQGATASVYKARNKKSGELVAV---------------------------------KVF 40
            |.....:|.|:..|||...|..:|||:||                                 |:.
Yeast   415 WLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIE 479

Human    41 NTTSYLRPREVQ----------VREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLL 95
            :..:...|:..|          ..|..:|::|:|:|||..:...:.||:..  :.:||...||:.
Yeast   480 DVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLN--IFLEYVPGGSVS 542

Human    96 SVLESPENAFGLPEDEFLVV--LRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDF 158
            |:|    |.:| |.:|.|:.  .|.::.|:.:|.:..|:|||||..||  |:..:|  ..|:|||
Yeast   543 SML----NNYG-PFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANI--LIDIKG--CVKITDF 598

Human   159 GAARELD----DDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSL 219
            |.:::|.    ...|..|:.|:..::.|::.        :|.|.....|:||.|..:....||..
Yeast   599 GISKKLSPLNKKQNKRASLQGSVFWMSPEVV--------KQTATTAKADIWSTGCVVIEMFTGKH 655

Human   220 PFIPFGGPRRNKEIMYRITTEKPAGAIAGAQR--RENGPLEWSY 261
            ||..|...:...:|....|.|.|:.|.:..:.  |:...|::.|
Yeast   656 PFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQY 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IKBKENP_054721.1 PKc_like 15..330 CDD:328722 76/298 (26%)
UBL_TBK1_like 297..383 CDD:240618
Interaction with DDX3X 383..647
Leucine-zipper 436..457
STE11NP_013466.1 SAM_Ste11_fungal 20..82 CDD:188933
Ras_bdg_2 121..224 CDD:405528
PKc_like 415..712 CDD:419665 77/304 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.